Identifiers and Description

Gene Model Identifier

TTHERM_00425950

Standard Name

UTP18 (U3 small nucleolar RNA-associated protein UTP18 homolog)

Aliases

PreTt14030 | 47.m00225

Description

Small-subunit processome protein involved in pre-18S rRNA maturation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF04841 ) Vps16, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00425950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00199.19.997093137033517e-262hypothetical protein (533 aa)
OxytrichaContig2665.0.g976.000287828677204e-80WD domain, G-beta repeat
SGDYJL069C1.000403801267624e-40UTP18 Possible U3 snoRNP prote
in involved in maturation of p
re-18S rRNA, based on computat
ional analysis of large-scale
protein-protein interaction da
ta
WormBaseWBGene000151047.001594317853847e-31U3 small nucleolar RNA-associa
ted protein 18 homolog statu
s:Confirmed UniProt:P42000
protein_id:CCD61605.1
Stentor CoeruleusSteCoe_283041.9287498479639178e-22
DictyBaseDDB_G02712400.0000000000000299873730555305utp18 on chromosome: 2 positio
n 234746 to 236537

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00425950(coding)
ATGAGTGAAATCAAAAAAAAATCAAGCAAGAAGATCAATGCTGAGAAGCCTAACAGAAAG
GCTATCATTAAGATGAAAAAAATTCTTAATGGTAAAAAGAAAGTAGATGAATTAGAAGGA
TTAGATGATGTAATATACTCTTAAGATGAAGAAAATGACAAGTAGCAACAAGATGAAAGT
GATGAAGAAGGTTAAAAAGATTAAAGTAATGGCGAGAATTTGTAATAAGCAGATGAGGAT
TCTCATGCTCTTGAACACTCAGAGTTCAATGATGATAATGAAGGAGCAGCTTGGGAGGAT
GATGACGATAAAAAGGTAGAAATCGATTTAACTCAAGCTGCAAGATTACGTAAATTGCGT
AAAACTGAAGATGAAAAAGTTGTAGACGGTGCTGAATATCAACGTAGACTTAAAAGTTTC
TACAATGATAGATTAAAACACACTAACTTTTATGGATGGGCTTATGACGATAAGGGTAAT
AAGCGCTAGTTAGAAGAAAGTGAAGAAGATTAGATGTTTGAAAATAATCCAAATAAAATC
TTAGATGATATGCTTAAAGTTTAGTATAGCGTATACGCTGAAGACAGCAAACCAGATAGC
ATATTAGCTGACATTATTGATATTGAGAGAATAGGCTAAACTCCCGTAAAAACTAAACAC
GAAGCTGTTGTTTAATCTATCGACTTCCATCCTAATAGCTAGATTTTCTTCACCTCCAGC
TTAGATAAATTAGTAAAGATATACACTATTAGAGAAAATAGACCTGCTTTTAGAGACAAT
GTAAAATTACTCAAATAACTCTACTTAGAAGGCATGCCTGTATTATCTGCTGGATTTATA
CCTTCTAAAAATGAAATCTTAGCATGTGGTATGAAGAAACACTTGCTCTCATATAATTTA
TTGAATGACAAGATTGAAAAGATTTCTTCCCATTTGTTCACTCAAAGATTCGATTAAAAA
ATTGAACACTTTGCTTTATCTCCCAACGAAGCTTATATTGCTTTGTTCAGTGAAGCAGGA
TATATCATGATTTTAAATGCAAAAACCAAATAATTCCTTTTTGAATTTAAAATGAATGAG
CCATGCACTTCTGTAGCTTTCTCTCATGACTCTAAGTATTTGTTCTCTGCTGGCAAAAAT
GGTAAGATCTACTAATGGGATATGTCAAAGAGATGCATTTTTGATGTTAACTAAGACCAA
GGCACACAAACAACTAATAAAATTAGAGTTTCTCAAAACGGTGACTACATCGCCACTTCT
TCCCCAAGTGGTATAGTCAACATTTACTCCTACAATAAAACTACTTAAACTATGGCAAAG
TCCACCACAAAAGAAATCTTAAATCTAACAACTTCAGTCGATACTCTCTGCTTTAACTAA
CAATCTGAATTATTATTAACTGCTTCAAAGTGGAAGAAAAATGCCATCAGACTCGTACAT
CTTCCATCATTTAATGTCTATCAAAATTGGCCTAACTTTAAAACTTAACTTAAATTCATA
ACTGCAGCTTCTTTCAGTCCTAATGGAAAATACATGGCTGTTGGAAACGATGCAGGTGTT
ACTTATCTTTATAATTTCAAGCATTACAGTTGA


>TTHERM_00425950(protein)
MSEIKKKSSKKINAEKPNRKAIIKMKKILNGKKKVDELEGLDDVIYSQDEENDKQQQDES
DEEGQKDQSNGENLQQADEDSHALEHSEFNDDNEGAAWEDDDDKKVEIDLTQAARLRKLR
KTEDEKVVDGAEYQRRLKSFYNDRLKHTNFYGWAYDDKGNKRQLEESEEDQMFENNPNKI
LDDMLKVQYSVYAEDSKPDSILADIIDIERIGQTPVKTKHEAVVQSIDFHPNSQIFFTSS
LDKLVKIYTIRENRPAFRDNVKLLKQLYLEGMPVLSAGFIPSKNEILACGMKKHLLSYNL
LNDKIEKISSHLFTQRFDQKIEHFALSPNEAYIALFSEAGYIMILNAKTKQFLFEFKMNE
PCTSVAFSHDSKYLFSAGKNGKIYQWDMSKRCIFDVNQDQGTQTTNKIRVSQNGDYIATS
SPSGIVNIYSYNKTTQTMAKSTTKEILNLTTSVDTLCFNQQSELLLTASKWKKNAIRLVH
LPSFNVYQNWPNFKTQLKFITAASFSPNGKYMAVGNDAGVTYLYNFKHYS


>TTHERM_00425950(gene)
ATGAGTGAAATCAAAAAAAAATCAAGCAAGAAGATCAATGCTGAGAAGCCTAACAGAAAG
GCTATCATTAAGATGAAAAAAATTCTTAATGGTAAAAAGAAAGTAGATGAATTAGAAGGA
TTAGATGATGTAATATACTCTTAAGATGAAGAAAATGACAAGTAGCAACAAGATGAAAGT
GATGAAGAAGGTTAAAAAGATTAAAGTAATGGCGAGAATTTGTAATAAGCAGATGAGGAT
TCTCATGCTCTTGAACACTCAGAGTTCAATGATGATAATGAAGGAGCAGCTTGGGAGGAT
GATGACGATAAAAAGGTAGAAATCGATTTAACTCAAGCTGCAAGATTACGTAAATTGCGT
AAAACTGAAGATGAAAAAGTTGTAGACGGTGCTGAATATCAACGTAGACTTAAAAGTTTC
TACAATGATAGATTAAAACACACTAACTTTTATGGATGGGCTTATGACGATAAGGGTAAT
AAGCGCTAGTTAGAAGAAAGTGAAGAAGATTAGATGTTTGAAAATAATCCAAATAAAATC
TTAGATGATATGCTTAAAGTTTAGTATAGCGTATACGCTGAAGACAGCAAACCAGATAGC
ATATTAGCTGACATTATTGATATTGAGAGAATAGGCTAAACTCCCGTAAAAACTAAACAC
GAAGCTGTTGTTTAATCTATCGACTTCCATCCTAATAGCTAGATTTTCTTCACCTCCAGC
TTAGATAAATTAGTAAAGATATACACTATTAGAGAAAATAGACCTGCTTTTAGAGACAAT
GTAAAATTACTCAAATAACTCTACTTAGAAGGCATGCCTGTATTATCTGCTGGATTTATA
CCTTCTAAAAATGAAATCTTAGCATGTGGTATGAAGAAACACTTGCTCTCATATAATTTA
TTGAATGACAAGATTGAAAAGATTTCTTCCCATTTGTTCACTCAAAGATTCGATTAAAAA
ATTGAACACTTTGCTTTATCTCCCAACGAAGCTTATATTGCTTTGTTCAGTGAAGCAGGA
TATATCATGATTTTAAATGCAAAAACCAAATAATTCCTTTTTGAATTTAAAATGAATGAG
CCATGCACTTCTGTAGCTTTCTCTCATGACTCTAAGTATTTGTTCTCTGCTGGCAAAAAT
GGTAAGATCTACTAATGGGATATGTCAAAGAGATGCATTTTTGATGTTAACTAAGACCAA
GGCACACAAACAACTAATAAAATTAGAGTTTCTCAAAACGGTGACTACATCGCCACTTCT
TCCCCAAGTGGTATAGTCAACATTTACTCCTACAATAAAACTACTTAAACTATGGCAAAG
TCCACCACAAAAGAAATCTTAAATCTAACAACTTCAGTCGATACTCTCTGCTTTAACTAA
CAATCTGAATTATTATTAACTGCTTCAAAGTGGAAGAAAAATGCCATCAGACTCGTACAT
CTTCCATCATTTAATGTCTATCAAAATTGGCCTAACTTTAAAACTTAACTTAAATTCATA
ACTGCAGCTTCTTTCAGTCCTAATGGAAAATACATGGCTGTTGGAAACGATGCAGGTGTT
ACTTATCTTTATAATTTCAAGCATTACAGTTGA