Identifiers and Description

Gene Model Identifier

TTHERM_00530130

Standard Name

UTP15 (U3 snoRNP protein Utp15)

Aliases

PreTt04682 | 67.m00197 | 3684.m00067

Description

Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01011 ) PQQ enzyme repeat
  • ( PF05972 ) APC 15 residue motif
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF04764 ) Protein of unknown function (DUF613)
  • ( PF08625 ) Utp13 specific WD40 associated domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00530130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13634.19.997093137033517e-262hypothetical protein (516 aa)
SGDYMR093W2.0000236365077126e-43UTP15 Nucleolar protein, compo
nent of the small subunit (SSU
) processome containing the U3
snoRNA that is involved in pr
ocessing of pre-18S rRNA
DictyBaseDDB_G02835812.9986404383886433e-43utp15 on chromosome: 4 positio
n 863530 to 865415
OxytrichaContig6026.0.g554.9986056260133516e-43UTP15 C terminal
WormBaseWBGene000212764.998978211117678e-38status:Partially_confirmed U
niProt:Q9N477 protein_id:CCD
68141.1
Stentor CoeruleusSteCoe_57004.359610000063081e-28

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530130(coding)
ATGTCATCATCAAATTATAAGCCTTTACAAGTCAAAAAGTTTGCTAAGAAAGCTATTAGT
GATACTCCAGAAAACAAATACTGGAAGAAGTTTAAGGTTGAAAGTTCCAAGACTTATGTA
AATGCCATTAATAAAGTATATTCAGGTGGAAATGATTCTGAGTTAATTGCCTTTACTGAA
GGAAGAATTGTTTATGTTTATAATTCAAAGAAGGAAGAGATTAAATAATAAATAGAAAGA
TTTTAAGATAAAGTTACTGGAATTTGCTTTAGAAAAGAAGGAAAAATGATGGCTACTGCT
GAAGCAAATGGTAAAATTAAAATATGGGAAGTCTCAAAGAAAACATTGCTTAGAGAATTC
AATGCTCACAAGAAAGCAGTAAACGCTATGGACTTTATTGGTGGAGAGTCTTATATGTAT
TCAGGATCAGATGATTATCAAATTAAACTCTATGATATAGCATCAAATGAAGTAGTTAGA
ACATACGTGAATGCTCATAGTGATTATGTCAGAAGTATAGTTTCTGTTCCAAATAGTGAT
AGAAATGTTATATCTGGTGGTTATGATGGCTTTGCAAACCTATTTGATTTTAGAGATAAA
TCTAAGAAACCTATTCGTTAATTCAATCACGGAGTTTCTATAGAAGATACTACAATTATT
CCTTCTGGTTTTTCTTTTGCAACTGTTGGTGGAACTTCAGTTAATATTTGGGATTTAAGA
ACAGGTAATGCTATCGAAACACTAAATCATAATTTAAAGACTATAACTTGTGCCAAATTT
ATAAGTAATGGTGATAGATTGATAACTTCTTCAATCGATTAAAGTATGAAAATATATAGA
ACAGATACTTACTAGATTACTCATCAATTTAAGTTCCCTTCTCCAGTTCTTAGTTTCGAT
ATGACTTAAAACACAAAATGTTTTGCTGTTGGTATGGCAGATGGTGTATTAGAGATAAGA
AGCAATTAAAAAAAGTTAGGAGAATAAGTTGATTCTGATGAAGAAAAAGATGATAAGGAA
GATTTAGGTTTATAAATTCCTGACTTTTTAAAATATAACGAAGCAGCATAAAGAAGAGTG
CATAATTTTTAATATTTTAGCAGAGGTATGTATGATAAGCCTACCTAATATGATGTAAAG
TATGAAGAAAAAAGAATTAAAAAAATAAGCAAGTACGATAAGCTTCTTAAAAAATTCCAA
TATAAAACCGCCATGATGCACGCTTTAGAAAATCGTTAAAATGACGTTGTTATTGGATTA
TATGAAGAATTAATTCAAAGGGGTGAAATAATAAATGCTTTTAAAAATTTAGATGATTCT
TAATTGAGTATAGTTTTTGAGTTTATAGCCAAAAAAATTGCAAACCCTAAATTTTAAGAT
GTCGCTATTCACATGTTGAACCTTATGTTTGAACAATACACTTATGAAAGTGGTAAGTAC
TTGGAAAGCATGGTTGATATACTTGACGAAGAAATTTTGACATAAAAATTGTTACTATAA
TTAAACGGATAAATAGATACAATAGTTAACACTAGCATTGTGGAATGA


>TTHERM_00530130(protein)
MSSSNYKPLQVKKFAKKAISDTPENKYWKKFKVESSKTYVNAINKVYSGGNDSELIAFTE
GRIVYVYNSKKEEIKQQIERFQDKVTGICFRKEGKMMATAEANGKIKIWEVSKKTLLREF
NAHKKAVNAMDFIGGESYMYSGSDDYQIKLYDIASNEVVRTYVNAHSDYVRSIVSVPNSD
RNVISGGYDGFANLFDFRDKSKKPIRQFNHGVSIEDTTIIPSGFSFATVGGTSVNIWDLR
TGNAIETLNHNLKTITCAKFISNGDRLITSSIDQSMKIYRTDTYQITHQFKFPSPVLSFD
MTQNTKCFAVGMADGVLEIRSNQKKLGEQVDSDEEKDDKEDLGLQIPDFLKYNEAAQRRV
HNFQYFSRGMYDKPTQYDVKYEEKRIKKISKYDKLLKKFQYKTAMMHALENRQNDVVIGL
YEELIQRGEIINAFKNLDDSQLSIVFEFIAKKIANPKFQDVAIHMLNLMFEQYTYESGKY
LESMVDILDEEILTQKLLLQLNGQIDTIVNTSIVE


>TTHERM_00530130(gene)
ATGTCATCATCAAATTATAAGCCTTTACAAGTCAAAAAGTGATTAATTATTCATAAGCCA
TCATTAAATCAACTGAAATATATTTAAATTAATTAGGTTTGCTAAGAAAGCTATTAGTGA
TACTCCAGAAAACAAATACTGGAAGAAGTTTAAGGTGATATATCATTTCATATTCTTTAC
TACTAATTGATTGATATATGATTAATTATATAATTAGAATATCATATAAAAGCATCTAAT
TTATTTCTTTGAAAATAGGTTGAAAGTTCCAAGACTTATGTAAATGCCATTAATAAAGTA
TATTCAGGTGGAAATGATTCTGAGTTAATTGCCTTTACTGAAGGAAGAATTGTAAGATGT
TATTTCTACAATAAAATTAATGTCTTGAAAATAGTGTACAGAATATTAATCTTCTACTTT
ATTAAAAAATTTAGGTTTATGTTTATAATTCAAAGAAGGAAGAGATTAAATAATAAATAG
AAAGATTTTAAGATAAAGTTACTGGAATTTGCTTTAGAAAAGAAGGTATTTAATATTAGA
ATTATGCCTTTTGTTTAGTAGAAGAACATTTAGCAATTTTCATAAAAAAATAATTTCTAA
TACAAATTTTAATTTTAAAGGAAAAATGATGGCTACTGCTGAAGCAAATGGTAAAATTAA
AGTAAACAGATTAATTTATATCGAATAAGATATTAAATTTTCTTTCAATTTATTTAGATA
TGGGAAGTCTCAAAGAAAACATTGCTTAGAGAATTCAATGCTCACAAGAAAGCAGTAAAC
GCTATGGACTTTATTGGTGGAGAGTCTTATATGTATTCAGGATCAGATGATTATGTAAAA
TATAAATATGAATTACATATGAAAATAATTAATTCATAATGACTAAAAAAAGCAAATTAA
ACTCTATGATATAGCATCAAATGAAGTAGTTAGAACATACGTGAATGCTCATAGTGATTA
TGTCAGAAGTATAGTTTCTGTTCCAAATAGTGATAGAAATGTTATATCTGGTGGTTATGA
TGGCTTTGCAAACCTATTTGATTTTAGAGATAAATCTAAGGTAATAAACTCTTTAAAATA
ATTTAATGTTTTCAAAATTAAATAATAAATATATTTCAGAAACCTATTCGTTAATTCAAT
CACGGAGTTTCTATAGAAGATACTACAATTATTCCTTCTGGTTTTTCTTTTGCAACTGTT
GGTGGAACTTCAGTTAATATTTGGGATTTAAGAACAGGTAATGCTATCGAAACACTAAAT
CATAATTTAAAGACTATAACTTGTGCCAAATTTATAAGTAATGGTGATAGATTGATAACT
TCTTCAATCGATTAAAGTATGAAAATATATAGAACAGATACTTACTAGATTACTCATCAA
TTTAAGTTCCCTTCTCCAGTTCTTAGTTTCGATATGACTTAAAACACAAAATGTTTTGCT
GTTGGTATGGCGTATGAAATTAATAAAAACTTATTTATCTGTTTATTTAATAATATTTTT
CATTTAAAACAGAGATGGTGTATTAGAGATAAGAAGCAATTAAAAAAAGTTAGGAGAATA
AGTTGATTCTGATGAAGAAAAAGATGATAAGGAAGATTTAGGTTTATAAATTCCTGACTT
TTTAAAATATAACGAAGCAGCATAAAGAAGAGTGCATAATTTTTAATATTTTAGCAGAGG
TATGTATGATAAGCCTACCTAATATGATGTAAAGTATGAAGAAAAAAGAATTAAAAAAAT
AAGCAAGTACGATAAGCTTCTTAAAAAATTCCAATATAAAACCGCCATGATGCACGCTTT
AGAAAATCGTTAAAATGACGTTGTTATTGGATTATATGAAGAATTAATTCAAAGGGGTGA
AATAATAAATGCTTTTAAAAATTTAGATGATGTAAATAAATTCTTTAAAATAATAGTTTT
TATCTTTAATCTATCTTAAATTAATAGTCTTAATTGAGTATAGTTTTTGAGTTTATAGCC
AAAAAAATTGCAAACCCTAAATTTTAAGATGTCGCTATTCACATGTTGAACCTTATGTTT
GGTAAATATATAAAAATACTTATTTTTTATTTTAGGCTCATATATATTTTTTATTAAATA
AAGAACAATACACTTATGAAAGTGGTAAGTACTTGGAAAGCATGGTTGATATACTTGACG
AAGAAATTTTGACATAAAAATTGTTACTATAATTAAACGGATAAATAGATACAATAGTTA
ACACTAGCATTGTGGAATGA