Identifiers and Description

Gene Model Identifier

TTHERM_00637800

Standard Name

UTP14 (small nucleolar ribonucleoprotein complex subunit Utp14)

Aliases

PreTt19783 | 91.m00198

Description

Subunit of U3-containing Small Subunit (SSU) processome complex involved in production of 18S rRNA and assembly of small ribosomal subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF04615 ) Utp14 protein
  • ( PF06991 ) Micro-fibrillar-associated protein 1 C-terminus

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00637800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03599.19.997093137033517e-262hypothetical protein (724 aa)
OxytrichaContig16608.0.g415.0013199114200274e-20Utp14 protein
SGDYML093W3.9992896861436003e-19UTP14 Subunit of U3-containing
Small Subunit (SSU) processom
e complex involved in producti
on of 18S rRNA and assembly of
small ribosomal subunit
DictyBaseDDB_G02793713.001003044337619e-17utp14 on chromosome: 3 positio
n 2000722 to 2004171
WormBaseWBGene000178550.00000000030007160092483236status:Confirmed UniProt:P91
280 protein_id:CCD66286.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00637800(coding)
ATGGCTGATAAAAAGAAAATTAAAAAGTAGGATAAAGAAGAGAAGTATAAAAAGCTATTA
CAAGCTATTGACATCAAGCTTGGTGAGGAGAAGGTTGATGAAAAATAAAAGAAAGTAGAA
GATCTCATTGCATCCTAAAAAAAGAATTAATAAGAATAGTAGAAGCCCGAAGAGGTTTTA
ACAATCTCAGGTCTTCTTTCTAAAATATAAGGAAATGATGAACAAGAGAATGCATAAAAT
TTAAAAAAATAATTAGAGGATCTTGAAAAAAGAAGTAAACTTCTTCATGAGCCAGAGTCT
TTCGTCAAATAGGAGAGAGCTGAAAGAAAAATTAATTATAAAATTGTTTAAGATGATGTA
GCTAAATGGATTCCTATTATTAAAAGGGCTAGAGAGGCTGATCATTTAGATTTTACACAA
AAGACTTAAGATAATTTGAGAATAAATGCAATTTCTGGAGATGAATTAAAAAGAAATAAA
ATTGCCATGAGCATTGAATAAAAATTATAACAATTAAATCTTAAGACTGAAAAGTAGATT
AAAGCTAAGGAGATAGAATTATTAGAAAAATTAGATCCTTAGGAAGCTAAAAGAAGAATT
AATGAAATGAATAAACAAAAAATGTTACTCTTCTAACAAGAAATTAAAAACAAAAGAGTA
GCTAAAATTAAGAGTAAGCTCTACCATAGAATTAAAAAGAAACAAAAACTCAGAGCTCAA
TTAAAAGAATATGAAAACATGGATGAAGAAGCAAGATTGTAATAGTAATAGGAATTATTA
GAAGAAAGAGCCAAAGAAAGAATTGGTATGAGACATAAAACTAAATCTAAACACATTTAA
TAAATGTTGAAGTATGGTGATAAGAAAACCTACTAATAGTCATTAAATGATATTAATCAT
TAGAGATAAGCTTTACTTAAAAAAACATAAGACATAGAAGTTAATTCAGATGATTTAGAT
TATGACTAACTCAATGATGAAGAATTTAAAGAACAAGCTATAAAAGACTTATAAAATGAG
CTTAAAGGAGGGGATGATGATGAATAGCAAGAAGAGCTAACTGGTATTAAATTCATTGAT
GATCTTCATAATTAAAAAAAGAATCAACATAGAGATGAAGCTCGTAAAATCATTGCTTAA
TTGTAAGATCCTGATGCTTTTGATAAAGAGATTTTGTCAGAAGATGATTTAATTGAAAGC
GATGATGAAGAAGGATAAAAGAAAAAAGCAGATAAGTTGAATGCAAAGAGAAAAGCTGAT
TAGGAAATTTTAGAAAAGGAAGAAGAATTCACAGGAAGAAAAATTTACAAAAAATCTGAA
CCTGAAGAGAAGTAAACAGAATTAGAAATCGAGATGGAGGAAATGAAATAAGCTAAAAAA
AAGAAAAGATTGAATGCTCTCGACATTGTAAAGGATCATATTAAATCTTAAAAGGAATAA
GAAGAAAACGAATAGGAAATTGAAAATGAATAATCTAAGAGTATTTCATAAAACGGAACA
AATAATAAGAAATAAGAAATATCTCAATAATCTACTATATAAGAAAAACTCAAAGAAGCA
TCAAAAAAAGTAGCAGCAACAACAATTAATGAAGAAAATTTGACTGATGGTTTGAACGTT
AATAAATTGAAAGAAAAATTCAAAAAAAATGCATAAACAGAGTTCAGTAAAAAGGAACTT
GAAGCATTCAACATAGAAAACAAAGAAGAAATCTACAAGGATTTATCTAATTTTAATGTT
TTAGTAGATGATGATAATGAGTAATAGTTTTTGGCAGAAAAGTATGAAGATTACGAAAAA
GACTTACCATAAGAGAAAAAGCCTTTATAAGGTTGGGGACATTGGGTTGGATAAGGTATT
GAATAAAAGAATTTACCTACTGCAGAAGAATTAGCAAGACAAAAGGCTGCTAAAATAAAT
TTACTCAAAAAGTAGAGAGCCGATGGCAGCATGGATAATGTTATATTGAACGAAAAGAGA
AATAAATTATTTACTTAGCATTTAGTCAAAGAACTTCCTCACCCATACAAAAACAAAGAA
CAATTCGAATACTTACACAATGCACCAATAGGTTCAGAATGGACAACTATGCGTAGTCAT
GTCAACTTAATCAAACCCAAAATAAAAACAAAGGCAGGAAACATTATTCAACCAGCTACC
GCTCCTAAATCCTTCTAATAATCTTGA


>TTHERM_00637800(protein)
MADKKKIKKQDKEEKYKKLLQAIDIKLGEEKVDEKQKKVEDLIASQKKNQQEQQKPEEVL
TISGLLSKIQGNDEQENAQNLKKQLEDLEKRSKLLHEPESFVKQERAERKINYKIVQDDV
AKWIPIIKRAREADHLDFTQKTQDNLRINAISGDELKRNKIAMSIEQKLQQLNLKTEKQI
KAKEIELLEKLDPQEAKRRINEMNKQKMLLFQQEIKNKRVAKIKSKLYHRIKKKQKLRAQ
LKEYENMDEEARLQQQQELLEERAKERIGMRHKTKSKHIQQMLKYGDKKTYQQSLNDINH
QRQALLKKTQDIEVNSDDLDYDQLNDEEFKEQAIKDLQNELKGGDDDEQQEELTGIKFID
DLHNQKKNQHRDEARKIIAQLQDPDAFDKEILSEDDLIESDDEEGQKKKADKLNAKRKAD
QEILEKEEEFTGRKIYKKSEPEEKQTELEIEMEEMKQAKKKKRLNALDIVKDHIKSQKEQ
EENEQEIENEQSKSISQNGTNNKKQEISQQSTIQEKLKEASKKVAATTINEENLTDGLNV
NKLKEKFKKNAQTEFSKKELEAFNIENKEEIYKDLSNFNVLVDDDNEQQFLAEKYEDYEK
DLPQEKKPLQGWGHWVGQGIEQKNLPTAEELARQKAAKINLLKKQRADGSMDNVILNEKR
NKLFTQHLVKELPHPYKNKEQFEYLHNAPIGSEWTTMRSHVNLIKPKIKTKAGNIIQPAT
APKSFQQS


>TTHERM_00637800(gene)
ATGGCTGATAAAAAGAAAATTAAAAAGTAGGATAAAGAAGAGAAGTATAAAAAGCTATTA
CAAGCTATTGACATCAAGCTTGGTGAGGAGAAGGTTGATGAAAAATAAAAGAAAGTAGAA
GATCTCATTGCATCCTAAAAAAAGAATTAATAAGAATAGTAGAAGCCCGAAGAGGTTTTA
ACAATCTCAGGTCTTCTTTCTAAAATATAAGGAAATGATGAACAAGAGAATGCATAAAAT
TTAAAAAAATAATTAGAGGATCTTGAAAAAAGAAGTGTAATTGATATTTTCATTAAATTT
TGTGAGTTTTGAATTAAGTTTTCATTTTTATTCCTTTTGATTCTAAATGTTTAAAAGTTT
ATTAATTCTATTTATACATAATTTGTATAGAAACTTCTTCATGAGCCAGAGTCTTTCGTC
AAATAGGAGAGAGCTGAAAGAAAAATTAATTATAAAATTGTTTAAGATGATGTAGCTAAA
TGGATTCCTATTATTAAAAGGGCTAGAGAGGCTGATCATTTAGATTTTACACAAAAGACT
TAAGATAATTTGAGAATGTAAAGGATTTATACATTGATTAAATTAATAGATATTAAGTTT
TTTATAGAGCTGTTTATAGCAAACACTTACATATCCTTAAAAGATTGAATTTATAAAAAT
ATTTTATTAATAATAGAAATGCAATTTCTGGAGATGAATTAAAAAGAAATAAAATTGCCA
TGAGCATTGAATAAAAATTATAACAATTAAATCTTAAGACTGAAAAGTAGATTAAAGCTA
AGGAGATAGAATTATTAGAAAAATTAGATCCTTAGGAAGCTAAAAGAAGAATTAATGAAA
TGAATAAACAAAAAATGTTACTCTTCTAACAAGAAATTAAAAACAAAAGAGTAGCTAAAA
TTAAGAGTAAGCTCTACCATAGAATTAAAAAGAAACAAAAACTCAGAGCTCAATTAAAAG
AATATGAAAACATGGATGAAGAAGCAAGATTGTAATAGTAATAGGAATTATTAGAAGAAA
GAGCCAAAGAAAGAATTGGTATGAGACATAAAACTAAATCTAAACACATTTAATAAATGT
TGAAGTATGGTGATAAGAAAACCTACTAATAGTCATTAAATGATATTAATCATTAGAGAT
AAGCTTTACTTAAAAAAACATAAGACATAGAAGTTAATTCAGATGATTTAGATTATGACT
AACTCAATGATGAAGAAGTAATTAACTTTGAATAATTTTTATTTTTTTATTAATTTTATT
TAATAAATATAGTTTAAAGAACAAGCTATAAAAGACTTATAAAATGAGCTTAAAGGAGGG
GATGATGATGAATAGCAAGAAGAGCTAACTGGTATTAAATTCATTGATGATCTTCATAAT
TAAAAAAAGAATCAACATAGAGATGAAGCTCGTAAAATCATTGCTTAATTGTAAGATCCT
GATGCTTTTGAGTAATATTTATTTTATATTAATTGTTTGTTGTTAATTCAAATCTTTTTT
ATATTTTAGTAAAGAGATTTTGTCAGAAGATGATTTAATTGAAAGCGATGATGAAGAAGG
ATAAAAGAAAAAAGCAGATAAGTTGAATGCAAAGAGAAAAGCTGATTAGGAAATTTTAGA
AAAGGAAGAAGAATTCACAGGAAGAAAAATTTACAAAAAATCTGAACCTGAAGAGAAGTA
AACAGAATTAGAAATCGAGATGGAGGAAATGAAATAAGCTAAAAAAAAGAAAAGATTGAA
TGCTCTCGACATTGTAAAGGATCATATTAAATCTTAAAAGGAATAAGAAGAAAACGAATA
GGAAATTGAAAATGAATAATCTAAGAGTATTTCATAAAACGGAACAAATAATAAGAAATA
AGAAATATCTCAATAATCTACTATATAAGAAAAACTCAAAGAAGCATCAAAAAAAGTAGC
AGCAACAACAATTAATGAAGAAAATTTGACTGATGGTTTGAACGTTAATAAATTGAAAGA
AAAATTCAAAAAAAATGCATAAACAGAGTTCAGTAAAAAGGAACTTGAAGCATTCAACAT
AGAAAACAAAGAAGAAATCTACAAGGATTTATCTAATTTTAATGTTTTAGTAGATGATGA
TGTAAACTAATTTTATTAAATCATTGAATCTTATTAAATTCAAATTTTAGAATGAGTAAT
AGTTTTTGGCAGAAAAGTATGAAGATTACGAAAAAGACTTACCATAAGAGAAAAAGCCTT
TATAAGGTATACAAACCTTTTAAATATTTTTATCTTTTAAAGCATGATTTAATTAAAAAC
AAAAAATAGGTTGGGGACATTGGGTTGGATAAGGTATTGAATAAAAGAATTTACCTACTG
CAGAAGAATTAGCAAGACAAAAGGCTGCTAAAATAAATTTACTCAAAAAGTAGAGAGCCG
ATGGCAGCATGGATAATGTTATATTGAACGAAAAGAGAAATAAATTATTTACTTAGCATT
TAGTCAAAGAACTTCCTCACCCATACAAAAACAAAGAACAATTCGAATACTTACACAATG
CACCAATAGGTAAATTATCAATTTTTTATTTTCTGTTTAAATTGATTCATTATAAATCTC
TATTTGATTATTTTTACTCCACTCTTATTACTAAGAAAAAAATTAAAATTAAACAACCAA
TTTTTACCTCTCGTTTGATGTAATTAAACCAGTTTATTTCTAACTAAGTTGTTAATTTGA
TCCTTTTAATTACTTTTGGGATAGATCCAAAAAAAAAATATGTTTTTAGAAGAGCCAAAT
TAAAACTAAAACAAGGGTTTTTTACAAAATAATAAACGTTGGCTCTCTATAAAATATTTT
ATGAGTTAATTTTAGAATTAATTTAAAACTTTTTTGTATTTTTAAATACGATTTACATAA
AAAATATAACTAAAAAATGAGATAATTTAATTTTGATGTTAAAAGAGAGTAATAAAATTA
ATTAAATGAAAAAATCTTAGTAATTTTATATTATTTTGACCTTTTTATTGTAAAAGATTA
TCCAAAATTAATTAATTTTTTCTTGAATCTGTAAATTAAAATATTCATAATATTAAACAA
AAAATAGGTTCAGAATGGACAACTATGCGTAGTCATGTCAACTTAATCAAACCCAAAATA
AAAACAAAGGCAGGAAACATTATTCAACCAGCTACCGCTCCTAAATCCTTCTAATAATCT
TGA