Identifiers and Description

Gene Model Identifier

TTHERM_00046770

Standard Name

UTP13 (Predicted U3 snoRNP-associated protein Utp13)

Aliases

PreTt11156 | 3.m01972 | 3824.m02917

Description

Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00046770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01774.19.997093137033517e-262hypothetical protein (1138 aa)
OxytrichaContig18453.0.g85.00040659480559e-153WD domain, G-beta repeat
DictyBaseDDB_G02762839.999776257620412e-83utp13 on chromosome: 2 positio
n 6600384 to 6603408
SGDYLR222C6.001309080488961e-82UTP13 Nucleolar protein, compo
nent of the small subunit (SSU
) processome containing the U3
snoRNA that is involved in pr
ocessing of pre-18S rRNA
WormBaseWBGene000131433.998181939598921e-51status:Partially_confirmed U
niProt:O18215 protein_id:CAB
16490.1
Stentor CoeruleusSteCoe_228023.3057006267607343e-37

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046770(coding)
ATGCCTAAATTTTAAGCCAAAAAGAAAATTTTTAAGTAGGATAAGTTTAAATCAAATGGA
AAAGGCAGTGGACCAGCTAAAAAAAATCCTGCCTTTATGCATAAGAAAAATAAGCTTAAT
AAATCCATTTAGAGAAATAATAAAAATTCTTAAAATCATTAAGTGAATGGAAAGAAAAAT
TTCAAAAAATTCAATAAAAATGATGCTCCTGCAAATAATAAATTCTAAAAAAAGAGTCAA
GACGATTTTGAAGACAATTTATCTAATGGTGAGTTTTAGGAATTATAAAAAAGCACTGCT
TAAGCTCAAAATAAAAAATAATAGATTCAAAAGTAATAATAGTCAACAAAGAAACCTTAG
GAACTAAAATCAGGAAACAATAAATAAAAGGGCCTTAAAAAATAAAATTAAAACGATGAC
ATTCAATTAGGAGGTGATGATTTAAGTGATAATGTTGATATAGATATGTCAGGTGAAGAA
GATCAAGAGTATAGTGATATAGATATTGATTAAAGTAGCTAAGGAGGATCTGAAAAAGAT
ATCAATAGTGAATAAAATGAAGATGATGACAATGATGAAGAAATCGAGGATAGTCATAAT
GAAAGCTAAGAAGGTAATGAAGATGAGTCTGAGTTTGATGAAGAAAATGATGAAAATTTT
AAGTCTGAAGTGATTGATAAGCTTCAAGATAAAGATTTCGAAGATTAGGAAGAAGCAGAT
GAAGAAGAAGAAAGTGAATTATAAGAAGAAGAAAATGAAATTGGGCATATTGAATAAGAA
TAAAATATAGATGAAGTAAAGGATGCTAGCAAAAGCTAAAACTAAGCAAATACTGTTGAA
GAAAAAGAAGTTATTAACCGTACCCATCTTGCAAAATATTGGTCAGTTGTTCTTTCTCAA
CCTTCAATTTACACAGGTGGTAGAATTTTGATTTCACCTAACGAAGAATTTATGGCTTCA
ATTGCTAACTTTAGAATAATTATTACTGATATCGCAACTCGTTAAATTATTAATTAAATT
ACTCATGAAGAAGAAGAGTTATGCAATTTTGCTATTCATCCTAGCAATAAGTTTATGGCA
ACTTTCACAAGAAACAATATTTTAAGATTTATAAATCTTGAGACAAAGGAAACAATTCAC
TCATGGAGAATAAACGATCAATGGGCTCTTGATATAGTTTTTGATACCACAGGTTAGTTT
ATGGCTATTGGCTGTGTTGATGGTTTCATTAAAGTTTATGATGTAAAGAAAGGAAATCTA
ACTCACAACTATAAGGTTCATAGAGGCTCAGTTACTAAATTATTGTTCCACCCCACTCCT
AACAAACTCCATTTGATTAGTGTTGGAGAAGATTACGCTATTAGAATTTATGATTTAGTT
ATTTCAACAGTTCTTAAGTCTATTGTTGCTCACACCTAAATGGTTACTTAGATTATCTTC
TCAGAAGATGGTACCAATCTTTTATCTGCAAGCTCTGATTAAAAAATTATAGTTTGGGAT
TATACCAATATGACTAAATAAGCCGAAGTCTTATTCGACGAATAAGTAGAAGCTATGGGA
TATTTAAAGATCAAAGCAAAATAAAACAAAAAGAATATTGTCTAATCTTATTTGGTAGCC
ACTGGAAGTTCTGGTATTCTGAAATTAATAGATATTACTTCAAATGATATTAAAATAATT
CCTTTTGAAAATCTTAAAACTCATGAAATCATCAAAATCATGACACTTCCTAAAAAGGAA
TAAATTTGTGCAGTTACTGTTGAATAGAACGTTATTTTTTACAGCTTCGTTGAAGGACCT
AGCTTGATAGAAAGTGACATTATTGTAGGTTTTAATGACGAAGTTACAGATGCTAAATTT
TGCAAAAAATAAAAGAAAGATAATTAAGTTTTTGAAAAAGAAAAAGAATATGTTGTTATT
TCAACAAACTCAAGCATCATGAAGGCTGTAGAACTTGGAACAGGAAAAACTCATTTTATT
AAAGGTCACTCTGATTTCGTTTTAACATTAGATACTTTTGGTCCATACATAATTTCTGCT
GGTAAAGACAAAACTGTAAAACTTTGGAAAAAGGCTGATAATTCATTTGAGTTTAAGCTT
TTAGCTACTTTTATTGGTCACGTAGAAGCTATTTCCTCAGTTTGTTTTGGTCCTAAAACC
GGTAAAATATTTGCTACTGGCTCTGAAGATTAAAATATAAAAATTTGGGACTCTTCAAAT
CTCATGGCCAGATCTCATAAAATACAAAAACCAGAAAATGTTACTAGTTCAAAAAGAACA
GTTTCTGCTCATACAAAAGATATCAATGTTGTCAAATTTTCTCCAAATGAAAAATTATTG
GCATCATCTTCTTAAGATCGTCAAATTAAAATTTGGGATACTGAAACTCTTAGTTGTAAG
ATGATTTTAAAAGGACACAAAAGAGGTGTATGGGATGTTAATTTCTCACCAGTTGAAAAA
TTATTAGCATCAGCTAGTGGTGATAGCACTGTCAAAGTATGGAATCTTGAAGATGGTTAA
TGCGTCAATACCTTCGAAGGTCACATGGGATCAGTATTAAAATGTTAATGGGTTTGCTAT
GGATTAGAAATTATTTCAGCTGGTGCTGATGGTCTTATAAAAATATGGAACACTAAAAAG
CAAACTTGCTTAAATACTCTGAACAAGCATTAAGGAAAAATTTGGGCTTTAGATATCTCT
GCTTATGACTAAAATGGTAAATAATTTATGCTTACCGGTGGTAACGATTCTAACTTCTTC
ATGTGGGAAGATGTTACTAAAGAAGAAGAACTTAAAAAGAAAGAAGAAGAGCATGAAGTA
CTCATTTAACAAGATAATTTCAAATAGCTTATTAGAAATTAAGATTATATAAATGCTGTA
AAGCTCGCTTTCAGATTTAATTTTGTTTCTAAATTCCACCAAGCTCTTGAGTTGATGTTC
CATAAAAAAGATTTCAAGAACGAAATTATTTACAGTGAGAACGAAATAAAATAAATCAAA
AAAAATAATGAAGAGGAAGATGAATTTGAAAAAAATATTAGAGAATTAGTTACAAATTTA
ATAGAGTTAGATATTAATAAATTGCTAATTTATATTAGAGATCTAAATACAATGCAAAAA
TCCTCTAAAGTAGCTTAGAGACTACTTAACTATGTTATCAGATCCATTCCTATTGATGAC
TATCAAGAAATTTCAAAGAAATTTAAAGTACCAAAGAAACCTTCCAAAAAAGAACAAGAA
GAATAAACTAAAATTCCTAGCGATTCTGAAAAGTCTGAATTTGAATAGCTACTTCAAGTA
ATAATCAGCTACTCTAAGAGACATGCAGAGCGTATGGAGCGTTTCATTAAAAAATCATAT
TATCTTGATTTTGTACTTAAAAAAATAGATCTTTTGTCTATTTAAGACGAAGAAAATAAT
AATAAAGAACATAATAAATCTGAAGCTACTAACAAAGCTTGA


>TTHERM_00046770(protein)
MPKFQAKKKIFKQDKFKSNGKGSGPAKKNPAFMHKKNKLNKSIQRNNKNSQNHQVNGKKN
FKKFNKNDAPANNKFQKKSQDDFEDNLSNGEFQELQKSTAQAQNKKQQIQKQQQSTKKPQ
ELKSGNNKQKGLKKQNQNDDIQLGGDDLSDNVDIDMSGEEDQEYSDIDIDQSSQGGSEKD
INSEQNEDDDNDEEIEDSHNESQEGNEDESEFDEENDENFKSEVIDKLQDKDFEDQEEAD
EEEESELQEEENEIGHIEQEQNIDEVKDASKSQNQANTVEEKEVINRTHLAKYWSVVLSQ
PSIYTGGRILISPNEEFMASIANFRIIITDIATRQIINQITHEEEELCNFAIHPSNKFMA
TFTRNNILRFINLETKETIHSWRINDQWALDIVFDTTGQFMAIGCVDGFIKVYDVKKGNL
THNYKVHRGSVTKLLFHPTPNKLHLISVGEDYAIRIYDLVISTVLKSIVAHTQMVTQIIF
SEDGTNLLSASSDQKIIVWDYTNMTKQAEVLFDEQVEAMGYLKIKAKQNKKNIVQSYLVA
TGSSGILKLIDITSNDIKIIPFENLKTHEIIKIMTLPKKEQICAVTVEQNVIFYSFVEGP
SLIESDIIVGFNDEVTDAKFCKKQKKDNQVFEKEKEYVVISTNSSIMKAVELGTGKTHFI
KGHSDFVLTLDTFGPYIISAGKDKTVKLWKKADNSFEFKLLATFIGHVEAISSVCFGPKT
GKIFATGSEDQNIKIWDSSNLMARSHKIQKPENVTSSKRTVSAHTKDINVVKFSPNEKLL
ASSSQDRQIKIWDTETLSCKMILKGHKRGVWDVNFSPVEKLLASASGDSTVKVWNLEDGQ
CVNTFEGHMGSVLKCQWVCYGLEIISAGADGLIKIWNTKKQTCLNTLNKHQGKIWALDIS
AYDQNGKQFMLTGGNDSNFFMWEDVTKEEELKKKEEEHEVLIQQDNFKQLIRNQDYINAV
KLAFRFNFVSKFHQALELMFHKKDFKNEIIYSENEIKQIKKNNEEEDEFEKNIRELVTNL
IELDINKLLIYIRDLNTMQKSSKVAQRLLNYVIRSIPIDDYQEISKKFKVPKKPSKKEQE
EQTKIPSDSEKSEFEQLLQVIISYSKRHAERMERFIKKSYYLDFVLKKIDLLSIQDEENN
NKEHNKSEATNKA


>TTHERM_00046770(gene)
ATGCCTAAATTTTAAGCCAAAAAGAAAATTTTTAAGTAGGATAAGTTTAAATCAAATGGA
AAAGGCAGTGGACCAGCTAAAAAAAATCCTGCCTTTATGCATAAGAAAAATAAGCTTAAT
AAATCCATTTAGAGAAATAATAAAAATTCTTAAAATCATTAAGTGAATGGAAAGAAAAAT
TTCAAAAAATTCAATAAAAATGATGCTCCTGCAAATAATAAATTCTAAAAAAAGAGTCAA
GACGATTTTGAAGACAATTTATCTAATGGTGAGTTTTAGGAATTATAAAAAAGCACTGCT
TAAGCTCAAAATAAAAAATAATAGATTCAAAAGTAATAATAGTCAACAAAGAAACCTTAG
GAACTAAAATCAGGAAACAATAAATAAAAGGGCCTTAAAAAATAAAATTAAAACGATGAC
ATTCAATTAGGAGGTGATGATTTAAGTGATAATGTTGATATAGATATGTCAGGTGAAGAA
GATCAAGAGTATAGTGATATAGATATTGATTAAAGTAGCTAAGGAGGATCTGAAAAAGAT
ATCAATAGTGAATAAAATGAAGATGATGACAATGATGAAGAAATCGAGGATAGTCATAAT
GAAAGCTAAGAAGGTAATGAAGATGAGTCTGAGTTTGATGAAGAAAATGATGAAAATTTT
AAGTCTGAAGTGATTGATAAGCTTCAAGATAAAGATTTCGAAGATTAGGAAGAAGCAGAT
GAAGAAGAAGAAAGTGAATTATAAGAAGAAGAAAATGAAATTGGGCATATTGAATAAGAA
TAAAATATAGATGAAGTAAAGGATGCTAGCAAAAGCTAAAACTAAGCAAATACTGTTGAA
GAAAAAGAAGTTATTAACCGTACCCATCTTGCAAAATATTGGTCAGTTGTTCTTTCTCAA
CCTTCAATTTACACAGGTGGTAGAATTTTGATTTCACCTAACGAAGAATTTATGGCTTCA
ATTGCTAACTTTAGAATAATTATTACTGATATCGCAACTCGTTAAATTATTAATTAAATT
ACTCATGTAAGATTTAAGAATATATTTACTTGTTTCTTTAAAAAATTAATGCTTTTAAAA
TAATTATTAGGAAGAAGAAGAGTTATGCAATTTTGCTATTCATCCTAGCAATAAGTTTAT
GGCAACTTTCACAAGAAACAATATTTTAAGATTTATAAATCTTGAGACAAAGGAAACAAT
TCACTCATGGAGAGTAAAGTTTATTTAAAAATTCTTTCAGTTTTTTAAGTATTACATCTA
ATTAAAATACAGATAAACGATCAATGGGCTCTTGATATAGTTTTTGATACCACAGGTTAG
TTTATGGCTATTGGCTGTGTTGATGGTTTCATTAAAGTTTATGATGTAAAGAAAGGAAAT
CTAACTCACAACTATAAGGTAACAAATACAGCAAACATTTGTTGATTTAGTTAATTAATA
TAAAATAATATTCAATAGGTTCATAGAGGCTCAGTTACTAAATTATTGTTCCACCCCACT
CCTAACAAACTCCATTTGATTAGTGTTGGAGAAGATTACGCTATTAGAATTTATGATTTA
GTTATTTCAACAGTTCTTAAGTCTATTGTTGCTCACACCTAAATGGTTACTTAGATTATC
TTCTCAGAAGATGGTACCAATCTTTTATCTGCAAGCTCTGATTAAAAAATTATAGTTTGG
GATTATACCAATATGACTAAATAAGCCGAAGTCTTATTCGACGAATAAGTAGAAGCTATG
GGATATTTAAAGATCAAAGCAAAATAAAACAAAAAGAATATTGTCTAATCTTATTTGGTA
GCCACTGGAAGTTCTGGTATTCTGAAATTAATAGATATTACTTCAAATGATATTAAAATA
ATTCCTTTTGAAAATCTTAAAACTCATGAAATCATCAAAATCATGTAAGCAAATTAATTG
TCAATAAAAAGATTAGCAAAAGTGTTAATTTTTATTTTATTTTAAAAATAAGGACACTTC
CTAAAAAGGAATAAATTTGTGCAGTTACTGTTGAATAGAACGTTATTTTTTACAGCTTCG
TTGAAGGACCTAGCTTGATAGAAAGTGACATTATTGTAGGTTTTAATGACGAAGTTACAG
ATGCTAAATTTTGCAAAAAATAAAAGAAAGATAATTAAGTTTTTGAAAAAGAAAAAGAAT
ATGTTGTTATTTCAACAAACTCAAGCATCATGAAGTATAAAAATTTAAATAAACCACATA
TTTTAAATTATTTTATCAATAAACAGGGCTGTAGAACTTGGAACAGGAAAAACTCATTTT
ATTAAAGGTCACTCTGATTTCGTTTTAACATTAGATACTTTTGGTCCATACATAATTTCT
GCTGGTAAAGACAAAACTGTAAAACTTTGGAAAAAGGCTGATAATTCATTTGAGTTTAAG
CTTTTAGCTACTTTTATTGGTCACGTAGAAGCTATTTCCTCAGTTTGTTTTGGTCCTAAA
ACCGGTAAAATATTTGCTACTGGCTCTGAAGATTAAAATATAAAAATTTGGGACTCTTCA
AATCTCATGGCCAGATCTCATAAAATACAAAAACCAGAAAATGTTACTAGTTCAAAAAGA
ACAGTTTCTGCTCATACAAAAGATATCAATGTTGTCAAATTTTCTCCAAATGAAAAATTA
TTGGCATCATCTTCTTAAGATCGTCAAATTAAAGTAAGAAAAAAATTATATTTTTAGTCA
AATTTATAATCAATTAAATTATTTATTTATTTATTACTTTTAGATTTGGGATACTGAAAC
TCTTAGTTGTAAGATGATTTTAAAAGGACACAAAAGAGGTGTATGGGATGTTAATTTCTC
ACCAGTTGAAAAATTATTAGCATCAGCTAGTGGTGATAGCACTGTCAAAGTATGGAATCT
TGAAGATGGTTAATGCGTCAATACCTTCGAAGGTCACATGGGATCAGTATTAAAATGTTA
ATGGGTTTGCTATGGATTAGAAATTATTTCAGGTAAAATTTATTTATTTAAAAACATCAC
AAAAATAATGATTTACATTAAAATAAATTAGCTGGTGCTGATGGTCTTATAAAAATATGG
AACACTAAAAAGCAAACTTGCTTAAATACTCTGAACAAGCATTAAGGAAAAATTTGGGCT
TTAGATATCTCTGCTTATGACTAAAATGGTAGATTATTAAATAATAATATTTATAATTTA
AATTAACTAAATTAAAGGTAAATAATTTATGCTTACCGGTGGTAACGATTCTAACTTCTT
CATGTGGGAAGATGTTACTAAAGAAGAAGAACTTAAAAAGAAAGAAGAAGAGCATGAAGT
ACTCATTTAACAAGATAATTTCAAATAGCTTATTAGAAATTAAGATTATATAAATGCTGT
AAAGCTCGCTTTCAGATTTAATTTTGTTTCTAAATTCCACCAAGCTCTTGAGTTGATGTT
CCATAAAAAAGATTTCAAGAACGAAATTATTTACAGTGAGAACGAAATAAAATAAATCAA
AAAAAATAATGAAGAGGAAGATGAATTTGAAAAAAATATTAGAGAATTAGTTACAAATTT
AATAGAGTTAGATATTAATAAATTGCTAATTTATATTAGAGATCTAAATACAATGCAAAA
ATCCTCTAAAGTAGCTTAGAGACTACTTAACTATGTTATCAGATCCATTCCTATTGATGA
CTATCAAGAAATTTCAAAGAAATTTAAAGTACCAAAGAAACCTTCCAAAAAAGAACAAGA
AGAATAAACTAAAATTCCTAGCGATTCTGAAAAGTCTGAATTTGAATAGCTACTTCAAGT
AATAATCAGCTACTCTAAGAGACATGCAGAGCGTATGGAGCGTTTCATTAAAAAATCATA
TTATCTTGATTTTGTACTTAAAAAAATAGATCTTTTGTCTATTTAAGACGAAGAAAATAA
TAATAAAGAACATAATAAATCTGAAGCTACTAACAAAGCTTGA