Identifiers and Description

Gene Model Identifier

TTHERM_00316240

Standard Name

UTP11 (Predicted U3 snoRNP protein Utp11)

Aliases

PreTt20935 | 31.m00237 | 3687.m00039

Description

Subunit of U3-containing Small Subunit (SSU) processome complex involved in production of 18S rRNA and assembly of small ribosomal subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF03998 ) Utp11 protein
  • ( PF08079 ) Ribosomal L30 N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00316240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08459.14.9987048861544946e-149Utp11 protein (249 aa)
OxytrichaContig17879.0.g653.9989916100764785e-24Utp11 protein
DictyBaseDDB_G02702301.0004572433669413e-23utp11 on chromosome: 1 positio
n 4445249 to 4446106
SGDYKL099C1.9994498063102785e-22UTP11 Subunit of U3-containing
Small Subunit (SSU) processom
e complex involved in producti
on of 18S rRNA and assembly of
small ribosomal subunit
WormBaseWBGene000076235.9971655715910366e-21Probable U3 small nucleolar RN
A-associated protein 11 stat
us:Confirmed UniProt:Q09462
protein_id:CAA86740.1
Stentor CoeruleusSteCoe_51750.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316240(coding)
ATGTCATCAACAACTTTTAAGAACTTAAAGATTGGCCGTAAGCATAGAGAAAGAGGCCAA
CTCAAAAATAGAGAACATTTGGGTATTTTAGAAAAGAAAAAAGATTACATCTAAAGAGCA
AAGCATTATCATAAGATTAATGATTAATTGAACAATTTGAAGCTTAAGGCAAGACTGAAA
AATGAAAATGAATTTTATCATAAAATGACTAAAGCTAAAATAGTTGATGGAAAGCATGTT
GAATTTGAAGAAGAAGAAGATGATTTTGACCCTAAGGAATATAGAAGATTGCTTAAAAAT
TAAAATATAAATCTAATTAAAATATAAAAGCACAAAGATATGAAACAAATTGAAAAACTG
AAAAGCCAATTGCATGATCTTGATGCTCCTAGATAAAACACTAATATTATATTTGTTGAT
GATAAAGAAGAATATGAAAATTTTGATTTAGTAGAGCATTACAATACTACAGAAGAAATG
ATATAAAATAAATCGAATATTTTAACTAAGCAACAAATTGAATAATAAAAAGAATAACTT
GAATAGTTAAATTCTAAGCAAATTAATTAAAAAGTTAAAGAATCTTACATGAAGCTTAAA
AAAGTAGAAGAAAATCACAAAAAAATGGAAAGAGCTTATCAAAAGCTAGAATTTGAAAAG
AATTTATTGGGTAAAGAAAAAAGAAGAATTAAAAAATACAAAACTGGCAAGGTTGCAAAG
TTTTTCAGTGAAAGAAAGAAATGA


>TTHERM_00316240(protein)
MSSTTFKNLKIGRKHRERGQLKNREHLGILEKKKDYIQRAKHYHKINDQLNNLKLKARLK
NENEFYHKMTKAKIVDGKHVEFEEEEDDFDPKEYRRLLKNQNINLIKIQKHKDMKQIEKL
KSQLHDLDAPRQNTNIIFVDDKEEYENFDLVEHYNTTEEMIQNKSNILTKQQIEQQKEQL
EQLNSKQINQKVKESYMKLKKVEENHKKMERAYQKLEFEKNLLGKEKRRIKKYKTGKVAK
FFSERKK


>TTHERM_00316240(gene)
ATGTCATCAACAACTTTTAAGAACTTAAAGATTGGCCGTAAGCATAGAGAAAGAGGCCAA
CTCAAAAATAGAGAACATTTGGGTATTTTAGAAAAGAAAAAAGATTACATCTAAAGAGCA
AAGCATTATCATAAGATTAATGATTAATTGAACAATTTGAAGCTTAAGGCAAGACTGAAA
AATGAAAATGAATTTTATCATAAAATGACTAAAGCTAAAATAGTTGTATGAAAATGATAT
TTGATTGATAAAATATTTCAATTTATGTTAATATTGTAATAATAGGATGGAAAGCATGTT
GAATTTGAAGAAGAAGAAGATGATTTTGACCCTAAGGAATATAGAAGATTGCTTAAAAAT
TAAAATATAAATCTAATTAAAATATAAAAGCACAAAGATATGAAAGTAAGTTAAAATTTT
AAGTGCTTTTTTGTTTTAATAATTTTCTATTTAACGAAAATCTTAGCAAATTGAAAAACT
GAAAAGCCAATTGCATGATCTTGATGCTCCTAGATAAAACACTAATATTATATTTGTTGA
TGATAAAGAAGAATATGAAAATTTTGATTTAGTAGAGCATTACAATACTACAGAAGAAAT
GATATAAAATAAATCGAATATTTTAACTAAGCAACAAATTGAATAATAAAAAGTAAATTA
ATTTTATTTAAAATTTATAAATTCTAAATATTGAACCTAATAAAATAATAAAAGGAATAA
CTTGAATAGTTAAATTCTAAGCAAATTAATTAAAAAGTTAAAGAATCTTACATGAAGCTT
AAAAAAGTAGAAGAAAATCACAAAAAAATGGAAAGAGCTTATCAAAAGCTAGAATTTGAA
AAGAATTTATTGGTATTTATTTTATAAATTTAAATCAAAATCTTAAATTAATAAATAAAT
AAATAATTTTAGGGTAAAGAAAAAAGAAGAATTAAAAAATACAAAACTGGCAAGGTTGCA
AAGTTTTTCAGTGAAAGAAAGAAATGA