Identifiers and Description

Gene Model Identifier

TTHERM_00649400

Standard Name

URM1 (Ubiquitin Related Modifier 1; URM1 ortholog)

Aliases

PreTt09254 | 94.m00172 | 3677.m00080

Description

RIKEN cDNA 2900073H19-related; Ubiquitin Related Modifier

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02597 ) ThiS family
  • ( PF09138 ) Urm1 (Ubiquitin related modifier)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00649400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17895.16.998463833652622e-61hypothetical protein (98 aa)
DictyBaseDDB_G02837374.000352986427571e-28urm1 on chromosome: 4 position
1046828 to 1047289
OxytrichaContig15751.0.0.g861.9999391735788327e-19Urm1 (Ubiquitin related modifi
er)
SGDYIL008W9.99946582325553e-18URM1 Ubiquitin-like protein in
volved in thiolation of cytopl
asmic tRNAs; receives sulfur f
rom the E1-like enzyme Uba4p a
nd transfers it to tRNA; also
functions as a protein tag wit
h roles in nutrient sensing an
d oxidative stress response
WormBaseWBGene001850480.00008003872323201264locus:urm-1 Ubiquitin-relate
d modifier 1 homolog status:
Confirmed UniProt:B3CKG1 p
rotein_id:CAX51654.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000160

Sequences

>TTHERM_00649400(coding)
ATGAAGGTAACAATTGAATTAAGCGGAGGATTAGATTTGTGCTTTGATGGCCACAAAACC
TTCGAAGTTGTTTTAGAAAACTAAGAAAATATTAAGATGGGAGATCTCATTACAGTTATT
GCTAAAAATTATGTTAAGAAGAAACCAGAATTCTTTGTTGGAGCTGACAATTAATTACGT
GCTGGAATTTTAGTTTTAATTAATGATGCTGATTGGGAACTTGAAGGCAAAGATGAAGCA
AATGTTGAGAATAAAGATAGAATTAGTTTCATTTCTACTCTTCACGGTGGTTGA


>TTHERM_00649400(protein)
MKVTIELSGGLDLCFDGHKTFEVVLENQENIKMGDLITVIAKNYVKKKPEFFVGADNQLR
AGILVLINDADWELEGKDEANVENKDRISFISTLHGG


>TTHERM_00649400(gene)
ATGAAGGTAACAATTGAATTAAGGTAATTTTTAAATAATTAGCAATTTTTTCAATTAGAA
CTTAATACAGAGTGCAAACTATATTTAAATAAAGCTATTATTAACTTGAAGATGATGATA
TTTTTACTTATAATGCAAATATACCCAATTGATCATTTCATATTATTTTAATTAATAAAT
AAATAGCGGAGGATTAGATTTGTGCTTTGATGGCCACAAAACCTTCGAAGTTGTTTTAGA
AAACTAAGAAAATATTAAGATGGGAGATCTCATTACAGTTATTGCTAAAAATTATGTTAA
GAAGAAACCAGAATTCTTTGTTGGAGCTGACAATTAATTGTATTAAATTTATTTATAATT
TTATAAATAAAAAATATATTGAAATTCTACATTAGTTTAATAATTTACTAAAAATTTATT
TTTCAAAGAAATATAAATTGATGCAGTCTATTAAATTGGAAGATTTTTTAACAAAATGCA
TTTAAAAAATACATTTTTTAATTATGATAAACAATCATATTTTAAGGAGACTTTATCAAA
TTTAAATTAATTTAAAAATAGACGTGCTGGAATTTTAGTTTTAATTAATGATGCTGATTG
GGAACTTGAAGGCAAAGATGAAGCAAATGTTGAGAATAAAGATAGAATTAGTTTCATTTC
TACTCTTCACGGTGGTTGA