Identifiers and Description

Gene Model Identifier

TTHERM_00146330

Standard Name

UPFL1 (UP-Frameshift protein-Like 1)

Aliases

PreTt26840 | 11.m00537 | 3702.m00259 | UPF1b

Description

One of two paralogs of UPF1.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00580 ) UvrD/REP helicase
  • ( PF00096 ) Zinc finger, C2H2 type
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR00376 ) DNA helicase, putative
  • ( PF07198 ) Protein of unknown function (DUF1410)
  • ( TIGR00959 ) signal recognition particle protein
  • ( PF04699 ) ARP2/3 complex 16 kDa subunit
  • ( TIGR01447 ) exodeoxyribonuclease V, alpha subunit
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR03158 ) CRISPR-associated helicase, Cyano-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.9%

TetraMine Data

TTHERM_00146330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04650.19.997093137033517e-262hypothetical protein (1221 aa)
DictyBaseDDB_G02889237.99705442073232e-89upf1 on chromosome: 5 position
2130048 to 2134208
OxytrichaContig17825.0.g1063.0008725323024365e-87RNA helicase (UPF2 interacting
domain)
WormBaseWBGene000048806.000861789407751e-87locus:smg-2 Regulator of non
sense transcripts 1 status:C
onfirmed UniProt:O76512 pr
otein_id:CCD73461.1
SGDYMR080C6.000861789407751e-87NAM7 ATP-dependent RNA helicas
e of the SFI superfamily invol
ved in nonsense mediated mRNA
decay; required for efficient
translation termination at non
sense codons and targeting of
NMD substrates to P-bodies; in
volved in telomere maintenance
Stentor CoeruleusSteCoe_39834.906094730649281e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28402567: Tian M, Yang W, Zhang J, Dang H, Lu X, Fu C, Miao W (2017) Nonsense-mediated mRNA decay in Tetrahymena is EJC independent and requires a protozoa-specific nuclease. Nucleic acids research 45(11):6848-6863
  2. Ref:SUPR000377

Sequences

>TTHERM_00146330(coding)
ATGAAAGGAAACTAGCAAAATCGTCATCTTGTTTGGCAAAAAGTATCTGAAATCAAAGGC
TTCTAGGTTTTATGCTTGGATTGCAGAGTTTTTTTCGATAACTAAAGAAATCCAAATAAC
TCTAATAATTCAAGTAGTATTGTTTCGCACTTAATCTAATCAAAGCATAACAAGGTTCAG
TTACTTATCAATTCAGGCATAGCAGTTTAAAAGCATATTGTTTGCTCATCATGTAAATTA
GGGGATGTTTTTAAACTTTAAATTTATGATTATCCTCAAGGTATTCTACTGCTTTGTAAT
GAGTGTTCTTTTAAATTTATAAATTAAACTAAATTTAAATAAGATTCTGAGGTTAAGCAC
TCAACAGTTATCTAATAAAATGAAATCAATTCCATTCTTTTTGATGCAAAGAGGGTTTAA
TTAAATCCAGATATTCTACAGATAAACTAAAATAAAAAATCTAAAGTTTAATACATCAGA
AAAGTTGATGTAGTAGAAGCAAATGCTGGACCACAAAATATTAGTTAAGCTTAATAATAA
AAATCAACAAATAATTTAAATTAAAATCCCTAATTAATCGGATCAGATAAAATATAAAAT
AAAAATTAAAATGCATCTCAAGAGTAAAAAATTGAAAAACTTTTAAAAATTTAATGCTTA
GATTGCAAATAATATTTTGACAACTAAAAAATAAATGGGTCTCTCAAAACAAGCATCATT
AAGCATCTTACTAAATAGAATCATAATAGAATTACCTGTATATTAAACTAAAATTAATAA
AAAAATATTACTCCAGATTGCTATAAATGCAAGAAAAGAAATGTTTTCGATTTAACAATA
TGTAAAGTTAATAATGAATAGTATTTACTATGCTCTTAATGTTTAAATAAAAGCAACGGC
AGTTTATTTACTAATGATCCAAATATAGCTATGAAATTGGTCAGCACTTTTCCAAATGAA
CCACTTATTACTAATTATTCAATTAATTCTACTTTCCTTGATCAATTAACGAAGAGCGAT
TAACCTAAATAAATTTAATCAGATTAAACCTAATTAAATTAGTAATCTATCCCACAAAAT
ATTTAAATAGGCTTAAATAATAATAATAATTAACTTTTAGTCAGTAATAACAGTAATAAC
GAAGATACATAAGTAAAGTGCCTTTAGTGTAATAATATATTTTAAAACTAAAGAAACAAG
CATGACAGTGTAACTCAAATAGTCAAACATTTAAAAAAGTGTTCCCACAATAAAATAGAA
ATATAAGAAAAGGCAAGAAAAACTTCTTTTTCTACATTTAAATGCCTATCATGCAATTAA
AACAACATTTTTGTTCTATTTATTGTAGAAATTGAATCATTTTACTTTGTTTTATGTAAC
TAATGTATAAATAGTAAGATGATTCAATTTTAAGGTAAAGACTCACAATCAATTGAAAAA
TGTAAGAAGTCTGCTATTGTGTAAAATGGATCAATAAATACTTTATTGATGAACCTGACC
ATCAAAAAAAAAGAATACTATCCAGTAAACAATGAGCACAAAAATTAACCTGACTAAAAC
TAAATAGAATAAGATAATAATGATGATGATTATGATTTTTGCCTAAATGGAGGTAATGAC
AATCAAGTTTAAGTAGGTATGTTGAATGACCCTAAAACCTAAAATATCAATAATTAAGAT
AGAAATTTTGACTAGTCTCGCAATCTCCAATCAATCCAAGTTAATTCTAGAGAGGAAAAA
AAAATTGAAATATTTAAAAATGTTGAAGCTTATTAACATTTTTTTAAAAAGATCTTAAAT
TAAGAATAATATGAAATATCTAAGTAGATATAATAAAGTGTTTTAACAACTAAAGCACTT
ATCTTATCAGAAAATCAGTTGTAAATATAAGTTTCCTCCAACCATCTATTAAAATAGGGT
AAAGAATTAAAAATTAAATGGGGTAATTTTAAATCCAAATTTTATGTAGAGAGTATTGAT
GATCATAAAATCGTTATTAAAATTTAAGATTCTAATAAATCTTTAAGTCGTTTCAAAGTA
GGAAATGTAGTAGAAAATGTTTAAATAAAATTAATCAATCCTAAATAGATTTTTGAAAGA
ATACTGTAGGGAATTAACAAATTTTCAAGTCTAGAAGAATCTTTGTAAAAAAAAATACTT
GGTTAATTTGAAAAGGATGATAAATCTATTAAAAGTGATGATTCATTAGAAATAATTGAC
GAATAAGCTCAATAAGATATAGCTTAGCTAAATTAAAGTTAGCTGTAAGCAATTTAGTCA
TCTCTCTCAAAAAATATTTCGCTGATTTAAGGTCCTCCAGGAACAGGAAAAACTGAAACA
GCAGCTCAGCTAGTTTTAGAAATATGGTATAAAATTAACAAAAATTAACAAAACGAAAAG
ATTTTAGTTTGTGCTCCATCAAACTTAGCTGCAGATAACATTTCAGATAGGATTCATGCA
TAAAATAGAGAAATAAAAGTAATAAGAATAGTTTCTTAAGCTAGGTAAAGAGTAAAAGTT
TCATATTAATTTCAAGATATAGTTCTGCATAAAGTACTAAAGAAAGAAGGTTTCTTTAAT
AAAAATAGTGTATTGAAAAGAGCAAAATAATTAATTGAAAATGCTGACGTCATTTGTACT
ACTTGCATTAATTCTGTAGATAAGTTTATAAAAGGTATTAGTTTTTCAACAGTAGTAATA
GATGAAGCAAACTAGGCAATAGAACCAGAAACAATAATACCTCTTTAGCATTAAGCTAAA
AAATTAATTTTGATAGGTGATCATAAATAATTGCCACCCATCATCTTAAGCATTTAAGCT
TCAAAAGATGGGTTAAAAAGAAGTTTATTTTCAAGACTTGTTTAAGCTGGTCTTATCCCT
TAATTTTTATCAATTCAGTATAGGATGCATCCAGAAATAAGAAAGTTAGCATCTTCTATA
TTCTATCAAAACTAGCTTAAAGATGGAGTTAATGAATAAGATAGAACTCCTACTCCGAAG
TTCAATTGGCTAAATAATAAAATTCCTATCTAATTTTATGATGTCTAAGGTTAAGAAATT
ACTTTGTAAGATGGTAAAAGTTTTATAAACGAAGAAGAAGCAAAGCTTGTAAAAAGTTTA
GTTTCTTAGCTTATATAAGCAGGTGTTAAAGATAATGATATTGGGATAATAACGCCTTAT
TTATCTTAATCTAATTATATAAGTTAATTAATAAAAAATAGCAATATTTTAATTGATACA
ACATACAGTTTCTAAGGACAAGAAAGAGACTACATAATAATTTCATGTGTAAGGATCAAT
AATTTTTAAAACTTAGGAATTTTAAGGACACCATAGCTGATTAACGTATCTATAACAAGA
GCTAAGAGAGGTTTACTAATAGTTGGAAACAAGAAACATGTGAGTTATTCAAGATGGTGG
AAACAAATCATTGATTATTTGGATAAATTAAAACTTATTTAAGAAATTAAAAAAGAGCCT
ATCGAAAATATTTATTCTATTGAGAACAATAAAATCATAAATAAAATTGATGAAAGGCTA
TGCTTCCATAAAAAAAGTTGA


>TTHERM_00146330(protein)
MKGNQQNRHLVWQKVSEIKGFQVLCLDCRVFFDNQRNPNNSNNSSSIVSHLIQSKHNKVQ
LLINSGIAVQKHIVCSSCKLGDVFKLQIYDYPQGILLLCNECSFKFINQTKFKQDSEVKH
STVIQQNEINSILFDAKRVQLNPDILQINQNKKSKVQYIRKVDVVEANAGPQNISQAQQQ
KSTNNLNQNPQLIGSDKIQNKNQNASQEQKIEKLLKIQCLDCKQYFDNQKINGSLKTSII
KHLTKQNHNRITCILNQNQQKNITPDCYKCKKRNVFDLTICKVNNEQYLLCSQCLNKSNG
SLFTNDPNIAMKLVSTFPNEPLITNYSINSTFLDQLTKSDQPKQIQSDQTQLNQQSIPQN
IQIGLNNNNNQLLVSNNSNNEDTQVKCLQCNNIFQNQRNKHDSVTQIVKHLKKCSHNKIE
IQEKARKTSFSTFKCLSCNQNNIFVLFIVEIESFYFVLCNQCINSKMIQFQGKDSQSIEK
CKKSAIVQNGSINTLLMNLTIKKKEYYPVNNEHKNQPDQNQIEQDNNDDDYDFCLNGGND
NQVQVGMLNDPKTQNINNQDRNFDQSRNLQSIQVNSREEKKIEIFKNVEAYQHFFKKILN
QEQYEISKQIQQSVLTTKALILSENQLQIQVSSNHLLKQGKELKIKWGNFKSKFYVESID
DHKIVIKIQDSNKSLSRFKVGNVVENVQIKLINPKQIFERILQGINKFSSLEESLQKKIL
GQFEKDDKSIKSDDSLEIIDEQAQQDIAQLNQSQLQAIQSSLSKNISLIQGPPGTGKTET
AAQLVLEIWYKINKNQQNEKILVCAPSNLAADNISDRIHAQNREIKVIRIVSQARQRVKV
SYQFQDIVLHKVLKKEGFFNKNSVLKRAKQLIENADVICTTCINSVDKFIKGISFSTVVI
DEANQAIEPETIIPLQHQAKKLILIGDHKQLPPIILSIQASKDGLKRSLFSRLVQAGLIP
QFLSIQYRMHPEIRKLASSIFYQNQLKDGVNEQDRTPTPKFNWLNNKIPIQFYDVQGQEI
TLQDGKSFINEEEAKLVKSLVSQLIQAGVKDNDIGIITPYLSQSNYISQLIKNSNILIDT
TYSFQGQERDYIIISCVRINNFQNLGILRTPQLINVSITRAKRGLLIVGNKKHVSYSRWW
KQIIDYLDKLKLIQEIKKEPIENIYSIENNKIINKIDERLCFHKKS


>TTHERM_00146330(gene)
ATGAAAGGAAACTAGCAAAATCGTCATCTTGTTTGGCAAAAAGTATCTGAAATCAAAGGC
TTCTAGGTTTTATGCTTGGATTGCAGAGTTTTTTTCGATAACTAAAGAAATCCAAATAAC
TCTAATAATTCAAGTAGTATTGTTTCGCACTTAATCTAATCAAAGCATAACAAGGTTCAG
TTACTTATCAATTCAGGCATAGCAGTTTAAAAGCATATTGTTTGCTCATCATGTAAATTA
GGGGATGTTTTTAAACTTTAAATTTATGATTATCCTCAAGGTATTCTACTGCTTTGTAAT
GAGTGTTCTTTTAAATTTATAAATTAAACTAAATTTAAATAAGATTCTGAGGTTAAGCAC
TCAACAGTTATCTAATAAAATGAAATCAATTCCATTCTTTTTGATGCAAAGAGGGTTTAA
TTAAATCCAGATATTCTACAGATAAACTAAAATAAAAAATCTAAAGTTTAATACATCAGA
AAAGTTGATGTAGTAGAAGCAAATGCTGGACCACAAAATATTAGTTAAGCTTAATAATAA
AAATCAACAAATAATTTAAATTAAAATCCCTAATTAATCGGATCAGATAAAATATAAAAT
AAAAATTAAAATGCATCTCAAGAGTAAAAAATTGAAAAACTTTTAAAAATTTAATGCTTA
GATTGCAAATAATATTTTGACAACTAAAAAATAAATGGGTCTCTCAAAACAAGCATCATT
AAGCATCTTACTAAATAGAATCATAATAGAATTACCTGTATATTAAACTAAAATTAATAA
AAAAATATTACTCCAGATTGCTATAAATGCAAGAAAAGAAATGTTTTCGATTTAACAATA
TGTAAAGTTAATAATGAATAGTATTTACTATGCTCTTAATGTTTAAATAAAAGCAACGGC
AGTTTATTTACTAATGATCCAAATATAGCTATGAAATTGGTCAGCACTTTTCCAAATGAA
CCACTTATTACTAATTATTCAATTAATTCTACTTTCCTTGATCAATTAACGAAGAGCGAT
TAACCTAAATAAATTTAATCAGATTAAACCTAATTAAATTAGTAATCTATCCCACAAAAT
ATTTAAATAGGCTTAAATAATAATAATAATTAACTTTTAGTCAGTAATAACAGTAATAAC
GAAGATACATAAGTAAAGTGCCTTTAGTGTAATAATATATTTTAAAACTAAAGAAACAAG
CATGACAGTGTAACTCAAATAGTCAAACATTTAAAAAAGTGTTCCCACAATAAAATAGAA
ATATAAGAAAAGGCAAGAAAAACTTCTTTTTCTACATTTAAATGCCTATCATGCAATTAA
AACAACATTTTTGTTCTATTTATTGTAGAAATTGAATCATTTTACTTTGTTTTATGTAAC
TAATGTATAAATAGTAAGATGATTCAATTTTAAGGTAAAGACTCACAATCAATTGAAAAA
TGTAAGAAGTCTGCTATTGTGTAAAATGGATCAATAAATACTTTATTGATGAACCTGACC
ATCAAAAAAAAAGAATACTATCCAGTAAACAATGAGCACAAAAATTAACCTGACTAAAAC
TAAATAGGTATTATATATTAAAATAAAATAAATTATTAAAAAATATTTTTTATCAACTAG
AATAAGATAATAATGATGATGATTATGATTTTTGCCTAAATGGAGGTAATGACAATCAAG
TTTAAGTAGGTATGTTGAATGACCCTAAAACCTAAAATATCAATAATTAAGATAGAAATT
TTGACTAGTCTCGCAATCTCCAATCAATCCAAGTTAATTCTAGAGAGGAAAAAAAAATTG
AAATATTTAAAAATGTTGAAGCTTATTAACATTTTTTTAAAAAGATCTTAAATTAAGAAT
AATATGAAATATCTAAGTAGATATAATAAAGTGTTTTAACAACTAAAGCACTTATCTTAT
CAGAAAATCAGTAAAATAAATTCAAAGATTAATAATATTTTATTGTTATTTCTATTAAAA
TTTAGGTTGTAAATATAAGTTTCCTCCAACCATCTATTAAAATAGGGTAAAGAATTAAAA
ATTAAATGGGGTAATTTTAAATCCAAATTTTATGTAGAGAGTATTGATGATCATAAAATC
GTTATTAAAATTTAAGATTCTAATAAATCTTTAAGTCGTTTCAAAGTAGGAAATGTAGTA
GAAAATGTTTAAATAAAATTAATCAATCCTAAATAGATTTTTGAAAGAATACTGTAGGGA
ATTAACAAATTTTCAAGTCTAGAAGAATCTTTGTAAAAAAAAATACTTGGTTAATTTGAA
AAGGATGATAAATCTATTAAAAGTGATGATTCATTAGAAATAATTGACGAATAAGCTCAA
TAAGATATAGCTTAGCTAAATTAAAGTTAGCTGTAAGCAATTTAGTCATCTCTCTCAAAA
AATATTTCGCTGATTTAAGGTCCTCCAGGAACAGGAAAAACTGAAACAGCAGCTCAGCTA
GTTTTAGAAATATGGTATAAAATTAACAAAAATTAACAAAACGAAAAGATTTTAGTTTGT
GCTCCATCAAACTTAGCTGCAGATAACATTTCAGATAGGATTCATGCATAAAATAGAGAA
ATAAAAGTAATAAGAATAGTTTCTTAAGCTAGGTAAAGAGTAAAAGTTTCATATTAATTT
CAAGATATAGTTCTGCATAAAGTACTAAAGAAAGAAGGTTTCTTTAATAAAAATAGTGTA
TTGAAAAGAGCAAAATAATTAATTGAAAATGCTGACGTCATTTGTACTACTTGCATTAAT
TCTGTAGATAAGTTTATAAAAGGTATTAGTTTTTCAACAGTAGTAATAGATGAAGCAAAC
TAGGCAATAGAACCAGAAACAATAATACCTCTTTAGCATTAAGCTAAAAAATTAATTTTG
ATAGGTGATCATAAATAATTGCCACCCATCATCTTAAGCATTTAAGCTTCAAAAGATGGG
TTAAAAAGAAGTTTATTTTCAAGACTTGTTTAAGCTGGTCTTATCCCTTAATTTTTATCA
ATTCAGTATAGGATGCATCCAGAAATAAGAAAGTTAGCATCTTCTATATTCTATCAAAAC
TAGCTTAAAGATGGAGTTAATGAATAAGATAGAACTCCTACTCCGAAGTTCAATTGGCTA
AATAATAAAATTCCTATCTAATTTTATGATGTCTAAGGTTAAGAAATTACTTTGTAAGAT
GGTAAAAGTTTTATAAACGAAGAAGAAGCAAAGCTTGTAAAAAGTTTAGTTTCTTAGCTT
ATATAAGCAGGTGTTAAAGATAATGATATTGGGATAATAACGCCTTATTTATCTTAATCT
AATTATATAAGTTAATTAATAAAAAATAGCAATATTTTAATTGATACAACATACAGTTTC
TAAGGACAAGAAAGAGACTACATAATAATTTCATGTGTAAGGATCAATAATTTTTAAAAC
TTAGGAATTTTAAGGACACCATAGCTGATTAACGTATCTATAACAAGAGCTAAGAGAGGT
TTACTAATAGTTGGAAACAAGAAACATGTGAGTTATTCAAGATGGTGGAAACAAATCATT
GATTATTTGGATAAATTAAAACTTATTTAAGAAATTAAAAAAGAGCCTATCGAAAATATT
TATTCTATTGAGAACAATAAAATCATAAATAAAATTGATGAAAGGCTATGCTTCCATAAA
AAAAGTTGA