Identifiers and Description

Gene Model Identifier

TTHERM_00726300

Standard Name

UPF1 (UP-Frameshift 1)

Aliases

PreTt21895 | 117.m00147

Description

An RNA helicase essential for nonsense-mediated mRNA decay (NMD)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA) | GO:0000184

Domains

  • ( PF00004 ) ATPase, AAA family
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR00376 ) DNA helicase, putative
  • ( TIGR01563 ) phage head-tail adaptor, putative
  • ( TIGR01447 ) exodeoxyribonuclease V, alpha subunit
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00726300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_174830
WormBaseWBGene000048809.997093137033517e-262locus:smg-2 Regulator of non
sense transcripts 1 status:C
onfirmed UniProt:O76512 pr
otein_id:CCD73461.1
Tetrahymena borealisEI9_04617.19.997093137033517e-262phage head-tail adaptor, famil
y protein (1081 aa)
DictyBaseDDB_G02889239.997093137033517e-262upf1 on chromosome: 5 position
2130048 to 2134208
OxytrichaContig17825.0.g1069.997093137033517e-262RNA helicase (UPF2 interacting
domain)
SGDYMR080C9.997093137033517e-262NAM7 ATP-dependent RNA helicas
e of the SFI superfamily invol
ved in nonsense mediated mRNA
decay; required for efficient
translation termination at non
sense codons and targeting of
NMD substrates to P-bodies; in
volved in telomere maintenance

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22184018: Lu XY, Xiong J, Yuan DX, Miao W (2011) [Alternative splicing of an ATP-binding cassette transporter ABCC10 in Tetrahymena thermophila]. Dong wu xue yan jiu = Zoological research 32(6):605-10
  2. Ref:SUPR000382

Sequences

>TTHERM_00726300(coding)
ATGAGTTAGAATAAGTAAAAGAGAAAAGTTGATTCAAGTAGTGAAGGTGAAGAGAGTGAA
GATGATTCTACAGAATAAAATTAAGATAATGAATCCACATAATAAGGAGGAGAAAATGAA
GATGAAGTATTTGATATTGATTTTAAAAATTTACCCTCACACGCATGCGAATATTGTGGT
GTCCATAATAAGAATAGTGTTATAAAGTGTCTAAATAAAGATTGCAACAAATGGTTTTGC
AATGGTAAACAATAAGGTTAGGGAGCATCTCATATTATTATGCATTTAGTTAAATCTAAA
CACAAAGAAATTTAGGTACACCCTGAGAACTAAAACTCAGATACTACTATTGAATGTTAC
ATTTGTGAGAATAAAAATATATACTTATTAGGTTTAGTTCACTTAAAAAATTAAGAAGAT
CAAGGTTTGATTATTTGTAGACAACCTTGCTTGAATCTAAAAAAGTATAATGAGATGTAA
TGGGAAATTGAAAAATGGAATCCTTTAATTGATGAAAAGATGATTGTTTCTTGGTTAGCT
TCACCACCAAGCGCCAAGCAAATGGAAAAAGGGTTTAAAGTTTCTTAGAAGCAAATTTAC
GAGTACGAGGAGTAAATTAAAACTAACCCCAATTTTAAATTAGCATAAGGTGCTGCTTAA
AGTTAAGTCAAGAAACTAAAACCAGTGTTATTGCGTTATAAAACTGGTAAATAGTATTTC
TAAACATTCTACAACTTAATTGAAGCTGAGGCTAACTATGACAAAGCTTTAAAGGAAAAT
CTTCATTACAACAGCATTACTGTTAAGTGGGATATTTCTTTAAAGAGTAGAAAAGTGGCT
CAATTTGTATTGCCTTAGGGAGAAGATAATGAATTCAACCTTTTGAGTGGTTCTGAATTA
AAGATCACCTACAAAAAGAATAAGAAAGATGAAGAATGGTCTGCCAAGGGTACTATAACT
AAAGTCGGAAATAATGATGAAGTCTTTGTTGAACTAAGTCATAATGTAAAAGATACCCCA
CCATCAGGAAAGGGATACACAATAGAATTTGTATGGAAACATACTGCTGTTAAGCGTATT
AAAAAAGGTATTAAGAAATTCTGGTAAGATGAAAAATGCATTAGCTCGTTCTTATACTTT
TAAATTCTTGGTCATTAGAACGAAGAACAGTAAACACCTACTTTGGATATACAACTTCCT
AAGCATTATTCTTTACCCAAAATGCCTGAGCTCAACTATTATTAAGTTGAAGCAGTTAAA
AAGGCTCTTCAATAACCTCTTTGCTTGATTTAAGGTCCTCCAGGTACTGGTAAAACTTTT
ACAAGTACAGCAATCATTTACCATCTAGTAAAGAACATTTAAAAGAGCGGATAGAGAGGC
CAGGTTTTAGTCTGTGCTCCTTCTAACATCGTTGTAGATTAACTAGCAGAAAGAATACAC
TAGGCTGGTATCAAGGTAGTTAGAATGTGCTCTCGTTCTAGAGAAATGATTTCATCATCA
GTAGAATTCTTAACTTTGCACAATCAAGTAAGAAGTTTAGATTTCGATGAATACAAAGAA
ATGTAAAAGTTACTCGAGCTTAAAGAAGATTAAGGTGAGTTAGACCATGATGATGAAGAC
AAATATTATAGTTTAAAAAGATAAGGTGAAAAGGAAATTTTGAGAAATGCGGAAGTTATT
TGTTCGACTTGTATATCATCAGCAGACCCAAGATTGAAGGATATTAGATTCAAGCATGTT
CTAATTGATGAAGCTACATAAGCTATTGAACCAGAATGTTTGTTACCTATGTTGAAAGGA
GCTAAGCATGTCATTTTAGTAGGAGATCATAGATAATTGGGTCCTGTTGTTACTTGCAGA
GATACTGCAAAGGCTGGTTTGAATAAAAGTCTTTTTGAAAGAATGGTTAGTATGGGTATT
AGACCAATTAGATTGTAAGTTTAGTACAGAATGCATCCTGATCTCTCTATTTTCCCTTCA
AATACTTTCTATGAAGGAACTTTGTAAAATGGTGTAACTTTCAACGATAGACAATTCCAT
GGTGAATTCCCGTGGCCTAATAAAAATAAACCTTTGATGTTTTTAAATTCCTGTGGTGTT
GAAGAAATATCTTCAAGTGGTACCAGTTACTTAAATAGATAAGAAACTGCCTTAATTGAA
GATATTGTATTCAGATTAATAAAAGCTAAGGTAAAACCTGAATAAATAGGTATCATCACT
CCTTATAAAGGTTAAAGATTCTATATTGGCGATTACTTAAGTAAGAACGGACGTTTGAAC
CATGTCTTATATAGATAAATAGAAATTGCCTCTGTTGATGGATTTTAAGGAAGAGAAAAA
GATTATATAATTATTTCTTGTGTAAGAAGCAATGAGTGCTAAGGTATTGGTTTTTTAACA
GACCCACGTCGTCTTAACGTAGCTATTACAAGAGCTAGATACGGACTTATTATTGTCGGT
AATGCTAAGGTACTTGCAAGAGATAATCTTTGGAACAATCTTCTCAATCATATGAAAGAA
AACAAGGTTTTGGTTGATGGAACACTAAATGATCTAAGACAATGCACATTAAAGTTCAGA
TAACCTCAAAAATATGTACCTGAAAGATCAGAATTTTAAGATAACAATAATGACAATGAT
GATGCCAGGTCAACAGTTAGTTACAAAATAGATAACATAAACAACTTTGATCTTGAGTTG
CCTATTGGATTTGGATTTAGAAACAGTGAGTTTGGATTTAACAAAATGCCCTAAACAGAA
TAGTTCAGAAAGATTCAAAAAGATTAAACTCTCAATATGGTAAAGAATTATGGAACTTAG
CTTTACAATAACTAGAATAATTAAGAGATTTTCTTCTTTGGTTAGGACAGAGAATAAAAC
TATTATGATATTCCAAGCTAACAAAAAAATAATGTTCAGCCTAATTAGTTTAGAAACAAT
GGAGGCTTTACTAATTTGAATCCAAATTCTAATAATTAGAATGATTTCAATGGAAGAAAT
AGAGATGACTACAATAATTAAGATGAATAAGCTGAAGATCAAGAAGATGATAACTATACA
AATGGTGGTGATGAAATTTACACAGAAAAGCAAAACGATTACAACAATCCAATAATCTAG
AAGTCATAACCAAAAGATAACTCCTAGAACAGCAAATCAACTTCTTTTGGAGGTATCGGT
ACATTCAGTATAGGTGCTTAGAAATATAGTTAGTTTGATTTAGATTTACCTGATGAATTT
AAATGA


>TTHERM_00726300(protein)
MSQNKQKRKVDSSSEGEESEDDSTEQNQDNESTQQGGENEDEVFDIDFKNLPSHACEYCG
VHNKNSVIKCLNKDCNKWFCNGKQQGQGASHIIMHLVKSKHKEIQVHPENQNSDTTIECY
ICENKNIYLLGLVHLKNQEDQGLIICRQPCLNLKKYNEMQWEIEKWNPLIDEKMIVSWLA
SPPSAKQMEKGFKVSQKQIYEYEEQIKTNPNFKLAQGAAQSQVKKLKPVLLRYKTGKQYF
QTFYNLIEAEANYDKALKENLHYNSITVKWDISLKSRKVAQFVLPQGEDNEFNLLSGSEL
KITYKKNKKDEEWSAKGTITKVGNNDEVFVELSHNVKDTPPSGKGYTIEFVWKHTAVKRI
KKGIKKFWQDEKCISSFLYFQILGHQNEEQQTPTLDIQLPKHYSLPKMPELNYYQVEAVK
KALQQPLCLIQGPPGTGKTFTSTAIIYHLVKNIQKSGQRGQVLVCAPSNIVVDQLAERIH
QAGIKVVRMCSRSREMISSSVEFLTLHNQVRSLDFDEYKEMQKLLELKEDQGELDHDDED
KYYSLKRQGEKEILRNAEVICSTCISSADPRLKDIRFKHVLIDEATQAIEPECLLPMLKG
AKHVILVGDHRQLGPVVTCRDTAKAGLNKSLFERMVSMGIRPIRLQVQYRMHPDLSIFPS
NTFYEGTLQNGVTFNDRQFHGEFPWPNKNKPLMFLNSCGVEEISSSGTSYLNRQETALIE
DIVFRLIKAKVKPEQIGIITPYKGQRFYIGDYLSKNGRLNHVLYRQIEIASVDGFQGREK
DYIIISCVRSNECQGIGFLTDPRRLNVAITRARYGLIIVGNAKVLARDNLWNNLLNHMKE
NKVLVDGTLNDLRQCTLKFRQPQKYVPERSEFQDNNNDNDDARSTVSYKIDNINNFDLEL
PIGFGFRNSEFGFNKMPQTEQFRKIQKDQTLNMVKNYGTQLYNNQNNQEIFFFGQDREQN
YYDIPSQQKNNVQPNQFRNNGGFTNLNPNSNNQNDFNGRNRDDYNNQDEQAEDQEDDNYT
NGGDEIYTEKQNDYNNPIIQKSQPKDNSQNSKSTSFGGIGTFSIGAQKYSQFDLDLPDEF
K


>TTHERM_00726300(gene)
ATGAGTTAGAATAAGTAAAAGAGAAAAGTTGATTCAAGTAGTGAAGGTGAAGAGAGTGAA
GATGATTCTACAGAATAAAATTAAGATAATGAATCCACATAATAAGGAGGAGTATATATT
TATGCTTAATTTCATTTATTATTACTTCGAATTAAATATCGAAGAATATTTTTAAATCTA
ACTTTTAAAAAAAGGAAAATGAAGATGAAGTATTTGATATTGATTTTAAAAATTTACCCT
CACACGCATGCGAGTATGTTAATGAAATAAAATATTGGTTTTTGATTAAATTAAATAATA
TAAAATTAAAGATATTGTGGTGTCCATAATAAGAATAGTGTTATAAAGTGTCTAAATAAA
GATTGCAACAAAGTAAATATTAAATTTTAGCCTTATAGATTGTTTTAAATATTTTTTATA
AAAATAAATCATTAGTGGTTTTGCAATGGTAAACAATAAGGTTAGGGAGCATCTCATATT
ATTATGCATTTAGTTAAATCTAAACACAAAGTATGTTTGTTGATTATTAAATAGCAAATA
TCAATTTATCTTTAGATTTAAAAATGTTTTAGAGCAAAAGATAAAATTGGCTAAAAAAGT
AGAATATTAATTTTCATTTATCTAAAATTAGGAAATTTAGGTACACCCTGAGAACTAAAA
CTCAGATACTACTATTGAATGTTACATTTGTGAGAATAAAAATATATACTTATTAGGTTT
AGTTCACTTAAAAAATTAAGAAGATCAAGTAATAATTTAGCTTTGTTAGTTTTATTTTAA
AATTTTCGAAAAATAAACAACTTTAATTGTTTTCCAAAATGAATGTTAAAATAGGGTTTG
ATTATTTGTAGACAACCTTGCTTGAATCTAAAAAAGTATAATGAGATGTAATGGGAAATT
GAAAAATGGAATCCTTTAATTGATGAAAAGATGATTGTTTCTTGGTTAGCTTCACCACCA
AGCGCCAAGCAAATGGAAAAAGGGTTTAAAGTTTCTTAGAAGCAAATTTACGAGTACGAG
GAGTAAATTAAAACTAACCCCAATTTTAAAGTAAATCTATTGAAAAAAATCTTCAAAATT
TAATTTATTGCTTTTTAAATCTTCAAATTTAGTTAGCATAAGGTGCTGCTTAAAGTTAAG
TCAAGAAACTAAAACCAGTGTTATTGCGTTATAAAACTGGTAAATAGTATTTCTAAACAT
TCTACAACTTAATTGAAGCTGAGGCTAACTATGACAAAGCTTTAAAGGAAAATCTTCATT
ACAACAGCATTACTGTTAAGTAAATCTTTGTTATTTTTTTAAATTATATTGAATCTCATT
TCGTGTGCGTTTAATAGGTGGGATATTTCTTTAAAGAGTAGAAAAGTGGCTCAATTTGTA
TTGCCTTAGGGAGAAGATAATGAATTCAACCTTTTGAGTGGTTCTGAATTAAAGATCACC
TACAAAAAGAATAAGAAAGATGAAGAATGGTCTGCCAAGGGTACTATAACTAAAGTCGGA
AATAATGATGAAGTCTTTGTTGAACTAAGTCATAATGTAAAAGATACCCCACCATCAGGA
AAGGGATACACAATAGAATTTGTATGGAAACATACTGCTGTTAAGCGTATTAAAAAAGGT
ATTAAGAAATTCTGGTAAGATGAAAAATGCATTAGCTCGTTCTTATACTTTTAAATTCTT
GGTCATTAGAACGAAGAACAGTAAACACCTACTTTGGATATACAACTTCCTAAGCATTAT
TCTTTACCCAAAATGCCTGAGCTCAACTATTATTAAGTTGAAGCAGTTAAAAAGTAAATG
CTTTATTTGATGATTCTAGTTTCTATTGATATTTTTTAATAAAAGGGCTCTTCAATAACC
TCTTTGCTTGATTTAAGGTCCTCCAGGTACTGGTAAAACTTTTACAAGTACAGCAATCAT
TTACCATCTAGTAAAGAACATTTAAAAGAGCGGATAGAGAGGCCAGGTTTTAGTCTGTGC
TCCTTCTAACATCGTTGTAGATTAACTAGCAGAAAGAATACACTAGGCTGGTATCAAGGT
AGTTAGAATGTGCTCTCGTTCTAGAGAAATGATTTCATCATCAGTAGAATTCTTAACTTT
GCACAATCAAGTAAAATATTATTTATCGCGAATATAGCTATTTGATTTAAAGAGCTATTT
TAGAATATTTAACTAATAAACTAAACATTAATAGGTAAGAAGTTTAGATTTCGATGAATA
CAAAGAAATGTAAAAGTTACTCGAGCTTAAAGAAGATTAAGGTGAGTTAGACCATGATGA
TGAAGACAAATATTATAGTTTAAAAAGATAAGGTGAAAAGGAAATTTTGGTAAATATTTT
ATTATTTCTAAAGAGAAACTAAAAAACTTTTAAAATAAAGAGAAATGCGGAAGTTATTTG
TTCGACTTGTATATCATCAGCAGACCCAAGATTGAAGGATATTAGATTCAAGCATGTTCT
AATTGATGAAGCTACATAAGCTATTGAACCAGAATGTTTGTTACCTATGTTGAAAGGAGC
TAAGCATGTAGATTTAAAAATACTTTATTCATCCATCTTATTAATTAATTATGTAATTAG
GTCATTTTAGTAGGAGATCATAGATAATTGGGTCCTGTTGTTACTTGCAGAGATACTGCA
AAGGCTGGTTTGAATAAAAGTCTTTTTGAAAGAATGGTTAGTATGGGTATTAGACCAATT
AGATTGTAAGTTTAGTACAGAATGCATCCTGATCTCTCTATTTTCCCTTCAAATACTTTC
TATGAAGGAACTTTGTAAAATGGTGTAACTTTCAACGATAGACAATTCCATGGTGAATTC
CCGTGGCCTAATAAAAGTATATAATAATAATTTAAAAGAAATAAAAGTAATAAATAAGCT
TTTTTTAAAAAAAGATAAACCTTTGATGTTTTTAAATTCCTGTGGTGTTGAAGAAATATC
TTCAAGTGGTACCAGTTACTTAAATAGATAAGAAACTGCCTTAATTGAAGATATTGTATT
CAGATTAATAAAAGCTAAGGTAAAACCTGAATAAATAGGTATCATCACTCCTTATAAAGG
TTAAAGATTCTATATTGGCGATTACTTAAGTAAGAACGGACGTTTGAACCATGTCTTATA
TAGATAAATAGAAGTAAAATCTTAAAATTTTTAATTCTATATTAAAAAAATCCTCAATTT
AAATTATTAAAGATTGCCTCTGTTGATGGATTTTAAGGAAGAGAAAAAGATTATATAATT
ATTTCTTGTGTAAGAAGCAATGAGTGCTAAGGTATTGGTTTTTTAACAGACCCACGTCGT
CTTAACGTAGCTATTACAAGAGCTAGGTAAAAATTATTTAAATTAAAAAAATCATTAATT
TTTATTTCTAAATAAAAGATACGGACTTATTATTGTCGGTAATGCTAAGGTACTTGCAAG
AGATAATCTTTGGAACAATCTTCTCAATCATATGAAAGAAAACAAGGTTTTGGTTGATGG
AACACTAAATGATCTAAGACAATGCACATTAAAGTTCAGATAACCTCAAAAATATGTACC
TGAAAGATCAGAATTTTAAGATAACAATAATGACAATGATGATGCCAGGTCAACAGTTAG
TTACAAAATAGGTAATTTCACAACAACAAAAAACAAAAAAGGTTAATTAATATAATAAAA
TATAAAAAGATAACATAAACAACTTTGATCTTGAGTTGCCTATTGGATTTGGATTTAGAA
ACAGTGAGTTTGGATTTAACAAAATGCCCTAAACAGAATAGTTCAGAAAGATTCAAAAAG
GTAAATTTAAATTTAAAAAGAAATAAAATCAAAATAAAATATAAAAATGATAAATAATTA
AATTATAAAACACTCTAGATTAAACTCTCAATATGGTAAAGAATTATGGAACTTAGCTTT
ACAATAACTAGAATAATTAAGAGATTTTCTTCTTTGGTTAGGACAGAGAATAAAACTATT
ATGATATTCCAAGCTAACAAAAAAATAATGTTCAGCCTAATTAGTTTAGAAACAATGGAG
GCTTTACTAATTTGAATCCAAATTCTAATAATTAGAATGATTTCAATGGAAGAAATAGAG
ATGACTACAATAATTAAGATGAATAAGCTGAAGATCAAGAAGATGATAACTATACAAATG
GTGGTGATGAAATTTACACAGAAAAGCAAAACGATTACAACAATCCAATAATCTAGAAGT
CATAACCAAAAGATAACTCCTAGAACAGCAAATCAACTTCTTTTGGAGGTATCGGTACAT
TCAGTATAGGTGCTTAGAAATATAGTTAGTTTGATTTAGATTTACCTGATGAATTTAAAT
GA