Identifiers and Description

Gene Model Identifier

TTHERM_00794250

Standard Name

UNG1 (Uracil DNA N-Glycosylase)

Aliases

PreTt21424 | 134.m00104

Description

uracil-DNA glycosylase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00628 ) uracil-DNA glycosylase
  • ( PF03167 ) Uracil DNA glycosylase superfamily

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.9%

TetraMine Data

TTHERM_00794250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13300.12.0005951135209932e-158uracil-DNA glycosylase (308 aa
)
OxytrichaContig4825.0.g102.998543574353313e-72Uracil DNA glycosylase superfa
mily
WormBaseWBGene000132413.0012565309061457e-65locus:ung-1 status:Confirmed
UniProt:Q9U221 protein_id
:CAB60520.1
DictyBaseDDB_G02778775.9981191891941984e-64uglA on chromosome: 3 position
330250 to 331290
SGDYML021C2.000364041471746e-45UNG1 Uracil-DNA glycosylase, r
equired for repair of uracil i
n DNA formed by spontaneous cy
tosine deamination, not requir
ed for strand-specific mismatc
h repair, cell-cycle regulated
, expressed in late G1, locali
zes to mitochondria and nucleu
s
Stentor CoeruleusSteCoe_49501.3336148155022614e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00794250(coding)
ATGTTTATATTTAGAAAATCAAGTTTTTTCTTTTAAAAAAATTTAATACTAAACTATTCA
ATAGCGAAAATACCTTAGCAGCTAACAGCACAAATGAGTTAAAAAAATATGACTGACTAT
TTTAAGGCTAAGCCTGAGGCAAAAGAAAAGCCTAAGAAGAAAGTAGCCAAAAATGAAATG
GAAGAAGAGGAAGAAGTGAAAGTAGATAAAGTAGAAAAAAAAGAAAAATTAGCTGGCGAA
TTCCCTACATTCGATGAATTTTAAGATGATTTATGTTCTTGGAAAGATATTTTAGGAACT
TACATAAAATCTCAAAAATTTAAAAGTATTTACACCTTTGTAAAGAAGGAGTATGCAGAT
AAAACATGTTATCCTCCTGCCCATGAGATATTCAATGTTTTCAAGTAGACTCCTCTTAAT
ACACTGAAAGTTGTAATCGTTGGCTAAGATCCTTATCACTAGCCTGGTTAAGCTATGGGT
CTTTGCTTCTCTGTAAAAAAGGGTGTTAAGCCACCTCCTTCCTTGGTCAATATATACAAA
TCTTTATCAAACGATCCTAAGATTAAAGGATTTAAAACACCAAATCATGGAGATTTAACT
AAGTGGGCAAATTAAGGTGTTTTTCTACTTAACGATATAATGACTGTTGAATATGATAAG
CCTGCTTCACACAGCAAATCTGGTTGGGCTGATTTCACTTCAGAAGTTATTAAAATAATA
AACAAAGAGTGCAAAGATATTGTATTCTTACTGTGGGGTAAGCCAGCATAAAAAAAGGCT
TCAATAGTTGATACAAAGAAGCATCACGTACTAGCTACTTCTCATCCATCTCCTTTAGGC
TATATGAAAGGATTTGATAAGGCGAATTGCTTCTCTGCATGTAATGAAATTCTTGTAAAG
CTTGGTAAAGAGCCTATAGATTGGTAGGTCTGA


>TTHERM_00794250(protein)
MFIFRKSSFFFQKNLILNYSIAKIPQQLTAQMSQKNMTDYFKAKPEAKEKPKKKVAKNEM
EEEEEVKVDKVEKKEKLAGEFPTFDEFQDDLCSWKDILGTYIKSQKFKSIYTFVKKEYAD
KTCYPPAHEIFNVFKQTPLNTLKVVIVGQDPYHQPGQAMGLCFSVKKGVKPPPSLVNIYK
SLSNDPKIKGFKTPNHGDLTKWANQGVFLLNDIMTVEYDKPASHSKSGWADFTSEVIKII
NKECKDIVFLLWGKPAQKKASIVDTKKHHVLATSHPSPLGYMKGFDKANCFSACNEILVK
LGKEPIDWQV


>TTHERM_00794250(gene)
ATGTTTATATTTAGAAAATCAAGTTTTTTCTTTTAAAAAAATTTAATACTAAACTATTCA
ATAGCGAAAATACCTTAGCAGCTAACAGCACAAATGAGTTAAAAAAGTACAATTTAATTG
TTAAACTTTTAGCTTAAACCAATTTTCAATTATAAAATAGATATGACTGACTATTTTAAG
GCTAAGCCTGAGGCAAAAGAAAAGCCTAAGAAGAAAGTAGCCAAAAATGAAATGGAAGAA
GAGGAAGAAGTGAAAGTAGATAAAGTAGAAAAAAAAGAAAAATTAGCTGGCGAATTCCCT
ACATTCGATGAATTTTAAGATGATTTATGTTCTTGGAAAGATATTTTAGGAACTTACATA
AAATCTCAAAAATTTAAAAGTATTTACACCTTTGTAAAGAAGGAGTATGCAGATAAAACA
GTAAAAATTGATCTTATTTCTCTAAACATGAATTAAAAAATTATATAAATAGTGTTATCC
TCCTGCCCATGAGATATTCAATGTTTTCAAGTAGACTCCTCTTAATACACTGAAAGTAGA
ATAATTTTTTTAGGAAATCTAATTTTATATAAAAAAACTATTATCAATAAAGGTTGTAAT
CGTTGGCTAAGATCCTTATCACTAGCCTGGTTAAGCTATGGGTCTTTGCTTCTCTGTAAA
AAAGGGTGTTAAGCCACCTCCTTCCTTGGTCAATATATACAAATCTTTATCAAACGATCC
TAAGATTAAAGGATTTAAAACACCAAATCATGGAGATTTAACTAAGTGGGCAAATTAAGG
TAATTAAAATTAATCAATATTTATTTTGATTATTTATCTTAGGTAGATTAAAATAATATA
TTTTGTTTGTTAAAGGTGTTTTTCTACTTAACGATATAATGACTGTTGAATATGATAAGC
CTGCTTCACACAGCAAATCTGGTTGGGCTGATTTCACTTCAGAAGTTATTAAAATAATAA
ACAAAGAGTGCAAAGATATTGTATTCTTACTGTGGGGTAAGCCAGCATAAAAAAAGGCTT
CAATAGTTGATACAAAGAAGTAAGAAATTTATCTTTTTAATTATTTTTAAACAAGTTATA
GCAATCATAATTGTGGAAATTATTTAAAAAAATATACTAAAAAGTTAATACATTAATTTT
ATAAATTTATTTTTTTTCTTTTGCTTATAATTTATTTACATTCTAGTTTCCAAATAAAAT
ATTTTGTTGGATGAAAGTTAATGAAAGCTAAATTTAGGTTTAGAAGATAATTTATTTAAT
AATGCAAAATAATTTTAAATAAAATTACATTTTTTTTTTTTAAGATTAAAAATTAATTAT
TATCTATTTTCTCCTCCTTACACTTTTGAAAAAAGCAATGATAACTGAATTATGCATATA
AATATTTTGTGAATACAAAATATTGTTATTTATTGTTATTTCAAAGATTTTTAAATGTGT
ATAATTTAATAAGATTTTATAAATACACTCTAATGATTATAAATATTATTGTTTTCTTAG
TATATAATTTTAAGATAATTTAAAAATGAAAAGTAGGAATAAAATTTTTACCCGTAGGTG
TAGATAAAATAATTATTTAAATGACAATTTTATTGAAAGCTTGTTTTTAATTATGCCTTT
AATATTACAAAAGGCTTAGAAATTTTAATAATATAAATCAAAAATATGATGCCCATTATT
TTTATTTGATTGTTAATTTTCAGCTTATAATAAGACTATCAAAAAAAATTAATATTATTA
TCAAAAAGGCATCACGTACTAGCTACTTCTCATCCATCTCCTTTAGGCTATATGAAAGGA
TTTGATAAGGCGAGTAAAAAATATGAATTAATTAAAAATTTTACATTTAATTTTAAATAA
AAAAATAGATTGCTTCTCTGCATGTAATGAAATTCTTGTAAAGCTTGGTAAAGAGCCTAT
AGATTGGTAGGTCTGA