Identifiers and Description

Gene Model Identifier

TTHERM_00442480

Standard Name

ULP3 (Ubiqiutin-Like Protease 1 paralog)

Aliases

PreTt05648 | 50.m00217 | 3681.m00076 | BCY1

Description

cyclic nucleotide-binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08035 ) Opioids neuropeptide
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( PF00753 ) metallo-beta-lactamase domain protein
  • ( PF02902 ) Ulp1 protease family, C-terminal catalytic

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00442480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12579.19.997093137033517e-262hypothetical protein (842 aa)
DictyBaseDDB_G02743831.000157752625888e-137pdeD on chromosome: 2 position
4904282 to 4907104
OxytrichaContig12595.0.g150.00000000002000577768187062Cyclic nucleotide-binding doma
in
WormBaseWBGene000011730.00000005001214305021125locus:egl-4 cGMP-dependent p
rotein kinase egl-4 status:C
onfirmed UniProt:O76360 pr
otein_id:CCD71861.1
SGDYIL033C0.00000019998969434520019BCY1 Regulatory subunit of the
cyclic AMP-dependent protein
kinase (PKA), a component of a
signaling pathway that contro
ls a variety of cellular proce
sses, including metabolism, ce
ll cycle, stress response, sta
tionary phase, and sporulation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00442480(coding)
ATGGCGTGTTGCTTGCAAAATGAAGATGATGGAAAATCAATAATTTCAGAAATTAATGAG
TAAATTGAAGAAATGTAACTCAAAAAAACGCTATCTTAAATTATTTAAGAGGCTTAAACA
AATAACAAATACAATTTAATGAGAGGAGGCTGTGTTATAAAATCTGCGATTGGCCCTATT
TAATTTGGTATTCCTCCAGAAACTGTGAAAGACTCATTAAATTTAGGATAGGAAGTTCCT
ACATTTTATATTATACCTTCTAAGAGATTTGATAAAAAGAATGGTGTAAATGTCGCTGAA
TTTGAATTCCCTGCCTATTTCAATTTTTTTGTTAAAAAACGTAAATGCACATTAATTTGT
ACTCAAGAAGCTGAAAGAGCAGTAAGAACAGTATTTTAGGAGACTCTTCTTGGTCCTGTT
AGTTTTGAACACATTGAAGAGGATTACTATTATTCTTATCCTAAAGATGGAATACCAGAT
TTTAATAAAGAATTAAAAGTTTTTGCAAAGAATCCTATGAACCCTAGTGAGGCTTTAAAA
GTTGATACTTTAATCAGTTTTGTTATTTTTGATGAAAATGGTGTAGCAAAATTAAACGAT
TCAAACGGAAATATTGTAGAAATCAAAAAAGAACAAGGGAGCTATTCTATTTTTGAAAAC
GGAAAACTCCTTGATAATGTAAAAGATGAAGTAAATCTACCTGAAGGAAATTTATTTGAG
AGTTTTGGAACTATCAGCACTGATAACATCAATAATATGAAAAATTCTGAATAATAAATA
GGCAATTAATTTAATCATGATAGAGTTACTTTTGAAAGTCCTACTAAATCTCATACTAAA
AATCTGATCGCAGTTTGGACAAGCAAACTTGGTTAAATGAAATGTATTTAGGATATTTAA
AATTTTCATCCTGAGTTTATCGATGAATCAGAAACCATTACTCCTCCTGATTTTGGTGTT
ACTGTCCTTGGTTCTTCTCATGGTTTTGATCCTAAGGGAAGCACTACTGGATTTATCATT
TGGATCTATGGTAAAGGTATAATGGTTGATCCCCCACCATTCAGCTCTTAATTTTTAAAG
AAAATGGGTATCCCTAGTGTACTAATTCATGGAATTATTATAACCCACTGTCATGCTGAT
CATGATGCAGGAACTTTCACTAAACTTCTTGATGATAGTAGAGTTGAAGTCATTACAACT
AGAACAATCATGAATAGCTTTTTGAGAAAATATAGTGCCTTGAGTGGAATGGGTATTGAA
GAACTTAAGCATTTGTTTATCTTTAGGCCAGTTACCTTAGGTACTTCTATTAATATATAT
GGAGCTAACTTTAGATTTTTTTATGCTTTCCATACTATACCTTGCATCGGATTCGAATGC
GAGCTTAAGCAGAGATCAATTTATTATTCTGCAGATACATTCTATAATCCTGAATAGTTA
AAAGAATTCAAAAGATAAGGGATATTTGGATAAAAAAGATATGAATAGTTAGCTAATGTC
AAATTTAACAATGACATTATTATTCACGAAGCTGGTGTTCCTCCTATTCACACACCTTAA
ACAGTTCTCGCTAGTCTCCCAATTCATATTAAAAATAAAATGATGCTCATTCACATCGCA
GAAAAAGATTTGCTTAAAGACAGTGGACTTAAAATAGCTAAGCACGGTATAGAAAATACT
TTAATATTACATCCTTCGGGATTTCATAAAAATATGGATACTTTAAGAAGACTTGACCTT
CTTTCTTCTATTGACATATTTGAAAACCTAACAATCAAAAACATTAAGTGGCTATTGGAT
TCCTTAGTAGAAGAGTAGTATTACCCTAAATAAATTGTAGTAAAAGAAAATACAATAGGT
AATAAGTTCTATATAATTGAAAGTGGCATTGCTCGTGTCTACTCAAATAATAAAAATAAT
TAATTTGAAAGATTTTATCAAACTGGAGAGTATTTTGGTGAAACTGCTCTAATATGCCAT
GGAGGAAAAAGAATTGCAAATGTAGAAGCAGTCACTGAACTTCGTTTACTCACTTTGGAA
AAACATGATTTCAAATTTATTTTTGGTGATGGATGTGGTGGAGATGGTCCTGTCATCAGA
AAGTTTATGAACTTAACTGATGCTCGTAAATCAAAGGCTCTGCACGTATTATACAAGAAT
TCTGTATTTAATGAGATGGGATAGTCATAAAAAACATAACTTGAAATGATTTTAAAAGAA
GAAGAAGTTGATAAAGGATAAGTTATGTGGAATGTAGGAGACAAGGCTACATTTGCCTTT
ATTATAAAGAAAGGTAATTTTGAATTTGTAGATTGCCCTGAATCTGAGTTAGATGAGCTA
GAGAGTGGTGCATTTATAGGAGAAGTTAAGTCAATAACTGATAGTTCACCTCTTACTACT
TCAGTTGTTGCAACTAGAAAAGGAAAAATATTTAAGATTTACAAAGAAGACCTCATTTCT
TTCTTAAATAAAAATCCTGGTTTATAACTTGTATTTTAGGATTGCAAGTACCTAGAATGA


>TTHERM_00442480(protein)
MACCLQNEDDGKSIISEINEQIEEMQLKKTLSQIIQEAQTNNKYNLMRGGCVIKSAIGPI
QFGIPPETVKDSLNLGQEVPTFYIIPSKRFDKKNGVNVAEFEFPAYFNFFVKKRKCTLIC
TQEAERAVRTVFQETLLGPVSFEHIEEDYYYSYPKDGIPDFNKELKVFAKNPMNPSEALK
VDTLISFVIFDENGVAKLNDSNGNIVEIKKEQGSYSIFENGKLLDNVKDEVNLPEGNLFE
SFGTISTDNINNMKNSEQQIGNQFNHDRVTFESPTKSHTKNLIAVWTSKLGQMKCIQDIQ
NFHPEFIDESETITPPDFGVTVLGSSHGFDPKGSTTGFIIWIYGKGIMVDPPPFSSQFLK
KMGIPSVLIHGIIITHCHADHDAGTFTKLLDDSRVEVITTRTIMNSFLRKYSALSGMGIE
ELKHLFIFRPVTLGTSINIYGANFRFFYAFHTIPCIGFECELKQRSIYYSADTFYNPEQL
KEFKRQGIFGQKRYEQLANVKFNNDIIIHEAGVPPIHTPQTVLASLPIHIKNKMMLIHIA
EKDLLKDSGLKIAKHGIENTLILHPSGFHKNMDTLRRLDLLSSIDIFENLTIKNIKWLLD
SLVEEQYYPKQIVVKENTIGNKFYIIESGIARVYSNNKNNQFERFYQTGEYFGETALICH
GGKRIANVEAVTELRLLTLEKHDFKFIFGDGCGGDGPVIRKFMNLTDARKSKALHVLYKN
SVFNEMGQSQKTQLEMILKEEEVDKGQVMWNVGDKATFAFIIKKGNFEFVDCPESELDEL
ESGAFIGEVKSITDSSPLTTSVVATRKGKIFKIYKEDLISFLNKNPGLQLVFQDCKYLE


>TTHERM_00442480(gene)
ATGGCGTGTTGCTTGCAAAATGAAGATGATGGAAAATCAATAATTTCAGAAATTAATGAG
TAAATTGAAGAAATGTAACTCAAAAAAACGCTATCTTAAATTATTTAAGAGGCTTAAACA
AATAACAAATACAATTTAATGAGAGGAGGCTGTGTTATAAAATCTGCGATTGGCCCTATT
TAATTTGGTATTCCTCCAGAAACTGTGAAAGACTCATTAAATTTAGGATAGGAAGTTCCT
ACATTTTATATTATACCTTCTAAGAGATTTGATAAAAAGAATGGTGTAAATGTCGCTGAA
TTTGAATTCCCTGCCTATTTCAATTTTTTTGTTAAAAAACGTAAATGCACATTAATTTGT
ACTCAAGAAGCTGAAAGAGCAGTAAGAACAGTATTTTAGGAGACTCTTCTTGGTCCTGTT
AGTTTTGAAGTAAATAAATGATTGATATTACTATTTAAACTAAGATAAAATTATATATTT
TAACAAAAATTTATTATGCAAAATCCTAACTAAATATTTAAAAATTTATTTAAAAGCACA
TTGAAGAGGATTACTATTATTCTTATCCTAAAGATGGAATACCAGATTTTAATAAAGAAT
TAAAAGTTTTTGCAAAGGTAACTATTGAACATATGCATTTTAAGCTAAATTTATTAATAA
TTATTTAAAATAATTAATGTAGAATCCTATGAACCCTAGTGAGGCTTTAAAAGTTGATAC
TTTAATCAGTTTTGTTATTTTTGATGAAAATGGTGTAGCAAAATTAAACGATTCAAACGG
AAATATTGTAGAAATCAAAAAAGAACAAGGGAGCTATTCTATTTTTGAAAACGGAAAACT
CCTTGATAATGTAAAAGATGAAGTAAATCTACCTGAAGGAAATTTATTTGAGAGTTTTGG
AACTATCAGCACTGATAACATCAATAATATGAAAAATTCTGAATAATAAATAGGCAATTA
ATTTAATCATGATAGAGTTACTTTTGAAAGTCCTACTAAATCTCATACTAAAAATCTGAT
CGCAGTTTGGACAAGCAAACTTGGTTAAATGAAATGTATTTAGGATATTTAAAATTTTCA
TCCTGAGTTTATCGATGAATCAGAAACCATTACTCCTCCTGATTTTGGTGTTACTGTCCT
TGGTTCTTCTCATGGTACATACTAGATATAATTCAAAATAATAAAAAACTTATTTTGTTT
TTTAAAATATAAGGTTTTGATCCTAAGGGAAGCACTACTGGATTTATCATTTGGATCTAT
GGTAAAGGTATAATGGTTGATCCCCCACCATTCAGCTCTTAATTTTTAAAGAAAATGGGT
ATCCCTAGTGTACTAATTCATGGAATTATTATAACCCACTGTCATGCTGATCATGATGCA
GGAACTTTCACTAAACTTCTTGATGATAGTAGAGTTGAAGTAATAAATTTTTAATTTTTA
ATATTTATTTTTGCTTGTAATTTTACTGGAAGAATTCTACAATAATTTATTTAAATAGGT
CATTACAACTAGAACAATCATGAATAGCTTTTTGAGAAAATATAGTGCCTTGAGTGGAAT
GGGTATTGAAGAACTTAAGCATTTGTTTATCTTTAGGCCAGTTACCTTAGGTACTTCTAT
TAATATATATGGAGCTAACTTTAGATTTTTTTATGCTTTCCATACTATACCTTGCATCGG
ATTCGAATGCGAGCTTAAGCAGAGATCAATTTATTATTCTGCAGATACATTCTATAATCC
TGAATAGTAATTTTAAACTAGATTTATATAAAAAATAATCAATTAATCGTTTTTATAGGT
TAAAAGAATTCAAAAGATAAGGGATATTTGGATAAAAAAGATATGAATAGTTAGCTAATG
TCAAATTTAACAATGACATTATTATTCACGAAGCTGGTGTTCCTCCTATTCACACACCTT
AAACAGTTCTCGCTAGTCTCCCAATTCATGTAACAAATATATTAAATGTCAATCATTTGA
AAATTAAATTTTTTAACAAATTTAAAAGATTAAAAATAAAATGATGCTCATTCACATCGC
AGAAAAAGATTTGCTTAAAGACAGTGGACTTAAAATAGCTAAGCACGGTATAGAAAATAC
TTTAATATTACATCCTTCGGGATTTCATAAAAATATGGATACTTTAAGAAGACTTGACCT
TCTTTCTTCTATTGACATATTTGAAAACCTAACAATCAAAAACATTAAGTGGCTATTGGA
TTCCTTAGTAGAAGAGTAGTATTACCCTAAATAAATTGTAGTAAAAGAAAATACAATAGG
TAATAAGTTCTATATAATTGAAAGTGGCATTGCTCGTGTCTACTCAAATAATAAAAATAA
TTAATTTGAAAGATTTTATCAAACTGGAGAGTATTTTGGTGAAACTGCTCTAATATGCCA
TGGAGGAAAAAGAATTGCAAAGTAAAACATTATTAAAAACTCTCTATTTTTATCAAATTT
TTTTTAATTTTTTTAGTGTAGAAGCAGTCACTGAACTTCGTTTACTCACTTTGGAAAAAC
ATGATTTCAAATTTATTTTTGGTGATGGATGTGGTGGAGATGGTCCTGTCATCAGAAAGT
TTATGAACTTAACTGATGCTCGTAAATCAAAGGCTCTGCACGTATTATACAAGTAAATTA
TATTTTAAGGTGATTGAAAAGAAGTAAAATAATAAATTGATTTATTAATTATATTTAAAA
AGGAATTCTGTATTTAATGAGATGGGATAGTCATAAAAAACATAACTTGAAATGATTTTA
AAAGAAGAAGAAGTTGATAAAGGATAAGTTATGTGGAATGTAGGAGACAAGGCTACATTT
GCCTTTATTATAAAGAAAGGTAATTTTGAATTTGTAGATTGCCCTGAATCTGAGTTAGAT
GAGCTAGAGAGTGGTGCATTTATAGGAGAAGTTAAGTCAATAACTGATAGTTCACCTCTT
ACTACTTCAGTTGTTGCAACTAGAAAAGGAAAAATATTTAAGATTTACAAAGAAGACCTC
ATTTCTTTCTTAAATAAAAATCCTGGTTTATAACTTGTATTTTAGGATTGCAAGTACCTA
GAATGA