Identifiers and Description

Gene Model Identifier

TTHERM_00077170

Standard Name

ULP2 (Ubiquitin-Like Protease 2)

Aliases

PreTt10063 | 5.m00414 | 3828.m01324

Description

Ulp1 protease family, C-terminal catalytic domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01442 ) small, acid-soluble spore protein, gamma-type
  • ( PF02902 ) Ulp1 protease family, C-terminal catalytic

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00077170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07109.19.997093137033517e-262Ulp1 protease family, C-termin
al catalytic domain-containing
protein (592 aa)
DictyBaseDDB_G02935083.0010664139725277e-29DDB_G0293508 on chromosome: 6
position 2972530 to 2975733
WormBaseWBGene000067370.000000000000001999258566166494locus:ulp-2 status:Partially
_confirmed UniProt:Q23238
protein_id:CCD73695.1
OxytrichaContig7958.0.1.g710.0000000000019997478866288316Ulp1 protease family, C-termin
al catalytic domain
SGDYIL031W0.000000000010004361180063202ULP2 Peptidase that deconjugat
es Smt3/SUMO-1 peptides from p
roteins, plays a role in chrom
osome cohesion at centromeric
regions and recovery from chec
kpoint arrest induced by DNA d
amage or DNA replication defec
ts; potential Cdc28p substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00077170(coding)
ATGCATAAAGTTAAATAAAATAGTACTTAGCAGGTTATCAAAAAGAGGAGTTTATCTTAG
CTAATACAAATAGTTGAAGAAGAAATTTAGTTTCCAGATAACAACGTCACTGTAATGTCA
TCAATTCAAAAGCAGATTAAAAAGACTGAAAACTCATTTGTTCCTAGCTCAGGAAAAGAC
ATTGGCTAGCTGCGTAAGCTAGTTTTAAATCACGAATATTATACAAGCATAGATGGCAAT
ATCATTACTGAGAAATATATAAAATTAAAAAGGACTAGGAGAGCCATAAAAAAATAAAAA
TATCAGCAGCAATTTATGTTCTTGTAAACATAAGCTAATCCTTTCTCATAAACATAAACT
GCCTATTTGCAACCTTAATACTTTAATTAACTTTAAATACAAAATATGTATTCTCCAGCT
TTAGCGTAGAATTTATAGGGCACCAATTATGATTAACAATTATCTGCTTTTTAGTAAAAT
TAAATCATGCATCTATAAACTTTACCCTCCTTAGAATAAGCAAACAGCTAAATAATGAAG
CAATAGTTGGGACAACAATTGCTTGTGCCACAATAAAGTCTTTAAATTCAATAATAACAA
TCTATGATTTAAATATAAAACCACTCCCAAAATGGAGAGTACTAAGGAATGGTTAACAAT
TACATGAAAATGGATAGAGTTTAACTAAGCGTTAAGAAAGATGTGTCTAAATTGGATGAA
GAAAGTGAAAGCAACTTCTCTGACGATTACGAAGAAAGCAGCGAAAGTGATTAAATGGTT
TATGAAAAATTTTCTTATACTTACAGTTATATGTAGAACGACAGAAAAAAAGACATAACA
ATAGAACACCACGATTTAAAAAAATTGGTGCCTAACCAATACCTCAATGACACAATAGTT
AACTTTTTCTTGAAATTTTTTGAGGTTGAAATCCTAAGCTAGGAAATGAAAGAAAAGGTA
CTCATATTCAATACATACTTTATGTCTAAATTGGCGCCAAATGACCAAATAGAACAACTA
TCTTCAAGTAGCTTTGAAGTCATAAATGGCTTGTTTGAAAAAAATTACTAAGCTGTACGC
AGATGGATTAAAGAAGATATCTTTGAAAAATAATTCCTAGTATTTCCTCTCAATTTACCT
GAGCACTGGTCAGTCATCATAGTCTGCAACCACAAAAACTTATTCGACCAAGACGAAAAA
AGCGAAGCTAGACAATAAAATAGCTCAGAAAATCCTACTACCATAGATGAAGACGATGAA
TAAGACTAAGACAAAGAAATAAAGGACGAAAACTCATCAAATAAACCAAAAAAAGAATAT
AACAAGCCATGTTTAGTTTACTTTGACAGCTTTGGACTACTTGATCCAAAGTACTCAAAC
ATGATCAGATTATATCTCAACAAGGAGTATGAAACGAAGAAAAAGAGTACCATATAAAAG
AACATAGTTTATAACGAGAGAACATTACCTTCGCATTAACCTCTAATTCCTAGATAAACA
AACTACGTAGACTGTGGACTATACTTGTTAGAATATGTAGAGAATTTTTTGAACGACCCT
TAATAGATCCTTAGTTTATTCAATAATACGGAATTTGATGAGTGGATCCATTTAAGATGG
TTCCCTAGATGTAACATACATAAAAAAAGGAAGTTCATTAAAGAACTTTTGATAGATTTA
TCTAAGCTAAGTAAAGAAGAGGCAGCAAAGAATTATTAACAAAAGAGAGCTAATTTATTA
GAGCTTAAAAAAGATAATGCTAGCTAATATGATGAAATAGATATGGAAGAATTTGAAGAC
CATATTGATGAGATAGCTGAGTATGAAGAAGACTATCCTAATACTTAGGAAGAAAAACAT
AGACAACTCTTAGATTTCTATATGAATCCCAATTTTAACAAATACGATGTGGTTTGA


>TTHERM_00077170(protein)
MHKVKQNSTQQVIKKRSLSQLIQIVEEEIQFPDNNVTVMSSIQKQIKKTENSFVPSSGKD
IGQLRKLVLNHEYYTSIDGNIITEKYIKLKRTRRAIKKQKYQQQFMFLQTQANPFSQTQT
AYLQPQYFNQLQIQNMYSPALAQNLQGTNYDQQLSAFQQNQIMHLQTLPSLEQANSQIMK
QQLGQQLLVPQQSLQIQQQQSMIQIQNHSQNGEYQGMVNNYMKMDRVQLSVKKDVSKLDE
ESESNFSDDYEESSESDQMVYEKFSYTYSYMQNDRKKDITIEHHDLKKLVPNQYLNDTIV
NFFLKFFEVEILSQEMKEKVLIFNTYFMSKLAPNDQIEQLSSSSFEVINGLFEKNYQAVR
RWIKEDIFEKQFLVFPLNLPEHWSVIIVCNHKNLFDQDEKSEARQQNSSENPTTIDEDDE
QDQDKEIKDENSSNKPKKEYNKPCLVYFDSFGLLDPKYSNMIRLYLNKEYETKKKSTIQK
NIVYNERTLPSHQPLIPRQTNYVDCGLYLLEYVENFLNDPQQILSLFNNTEFDEWIHLRW
FPRCNIHKKRKFIKELLIDLSKLSKEEAAKNYQQKRANLLELKKDNASQYDEIDMEEFED
HIDEIAEYEEDYPNTQEEKHRQLLDFYMNPNFNKYDVV


>TTHERM_00077170(gene)
ATGCATAAAGTGTAATACATTTTGATTTACTATTAAAAGTGCAAGAAAAACATATATAGA
TATCAGTAAATAAAATAGTACTTAGCAGGTTATCAAAAAGAGGAGTTTATCTTAGCTAAT
ACAAATAGTTGAAGAAGAAATTTAGTTTCCAGATAACAACGTCACTGTAATGTCATCAAT
TCAAAAGCAGATTAAAAAGACTGAAAACTCATTTGTTCCTAGCTCAGGAAAAGACATTGG
CTAGCTGCGTAAGCTAGTTTTAAATCACGAATATTATACAAGCATAGATGGCAATATCAT
TACTGAGAAATATATAAAATTAAAAAGGACTAGGAGAGCCATAAAAAAATAAAAATATCA
GCAGCAATTTATGTTCTTGTAAACATAAGCTAATCCTTTCTCATAAACATAAACTGCCTA
TTTGCAACCTTAATACTTTAATTAACTTTAAATACAAAATATGTATTCTCCAGCTTTAGC
GTAGAATTTATAGGGCACCAATTATGATTAACAATTATCTGCTTTTTAGTAAAATTAAAT
CATGCATCTATAAACTTTACCCTCCTTAGAATAAGCAAACAGCTAAATAATGAAGCAATA
GTTGGGTAAATATTCAATTTATTATTTTTCTTTTCAAAATGCTTTAAGAAGCCTTAAATT
TATCATTAAAACTCATTCAAATAAAATATTTTTTCAAAAATAAAAGGACAACAATTGCTT
GTGCCACAATAAAGTCTTTAAATTCAATAATAACAATCTATGATTTAAATATAAAACCAC
TCCCAAAATGGAGAGTACTAAGGAATGGTTAACAATTACATGAAAATGGATAGAGTTTAA
CTAAGCGTTAAGAAAGATGTGTCTAAATTGGATGAAGAAAGTGAAAGCAACTTCTCTGAC
GATTACGAAGAAAGCAGCGAAAGTGATTAAATGGTTTATGAAAAATTTTCTTATACTTAC
AGTTATATGTAGAACGACAGAAAAAAAGACATAACAATAGAACACCACGATTTAAAAAAA
TTGGTGCCTAACCAATACCTCAATGACACAATAGTTAACTTTTTCTTGAAGTAAAAAAAG
ACTTTACTTAATAAAAAAAGAAAACAATATTTAATAAATAACATTTTTAACAATCTTGCA
TTTGTTTTAAAATAATAAAATATCTTTAATGAATCTTCTTATTTTTTGTCAATTTTGCTT
TAGTACTAATAATAAAATTTGTTATGATTAATAAATTTTATGGAATAACTTACTTTGCTA
TTTTATAATAGCATTTTCAATTATTTATTTTAAATAAAATAGATTTTTTGAGGTTGAAAT
CCTAAGCTAGGAAATGAAAGAAAAGGTACTCATATTCAATACATACTTTATGTCTAAATT
GGCGCCAAATGACCAAATAGAACAACTATCTTCAAGTAGCTTTGAAGTCATAAATGGCTT
GTTTGAAAAAAATTACTAAGCTGTACGCAGAGTAAAAACTAAATAAATAAATACATTAAA
TTAAAATTATTTTTTACTTTTGTTTAAAATAAAAACGTTAAAAATATTGAAAAATGAATT
CACATTTTAAAAGTATTTGCTTTTGAATAATTATTAATTTATTTGAACCAAATTAGCGCT
TATTTTTGAATACAAAGTTTTTAATTTTTGCTTAATAATTATACGTTAAATAACGATCAA
TCTTTTAATTAAAAGTGGATTAAAGAAGATATCTTTGAAAAATAATTCCTAGTATTTCCT
CTCAATTTACCTGAGCACTGGTCAGTCATCATAGTCTGCAACCACAAAAACTTATTCGAC
CAAGACGAAAAAAGCGAAGCTAGACAATAAAATAGCTCAGAAAATCCTACTACCATAGAT
GAAGACGATGAATAAGACTAAGACAAAGAAATAAAGGACGAAAACTCATCAAATAAACCA
AAAAAAGAATATAACAAGCCATGTTTAGTTTACTTTGACAGCTTTGGACTACTTGATCCA
AAGTACTCAAACATGATCAGATTGTAAAATTATTTTTTCTTCATATAAATTTATTTTTAA
CATCTCTTCCTAAGATATCTCAACAAGGAGTATGAAACGAAGAAAAAGAGTACCATATAA
AAGAACATAGTTTATAACGAGAGAACATTACCTTCGCATTAACCTCTAGTAAATCTTTAC
AAAACAATCTAATTCATTTTATCATCTAAAAAGTTGTAAAAACAGTTTTTTCATAAAATC
AAAAAATTCAAAATAAATTAAAAATTTTATTTTTTTAGTTTTTAATAGCTTTTTAAAAAT
GTTTTATTTCAATTAAGAATTTTAAGCTAATTTTTGATTGATTTTAGGCAATTTTTTTAA
TTGCTTTTGAAAAAAATAATTTAGAATTAACAAATAAGGTTTTTATTAAAATTTTTAATG
AATATTGAATTGATTAATTAAAAGTTAATTAAATAATAAAAATTAGATTCCTAGATAAAC
AAACTACGTAGACTGTGGACTATACTTGTTAGAATATGTAGAGAATTTTTTGAACGACCC
TTAATAGATCCTTAGTTTATTCAATAATGTATTAAAATTCACAAACTTAATTGTATTTTT
AATTAAATATATAAATAATAAAATTAGACGGAATTTGATGAGTGGATCCATTTAAGATGG
TTCCCTAGATGTAACATACATAAAAAAAGGAAGTTCATTAAAGAACTTTTGATAGATTTA
TCTAAGCTAAGTAAAGAAGAGGCAGCAAAGAATTATTAACAAAAGAGAGCTAATTTATTA
GAGCTTAAAAAAGATAATGCTAGCTAATATGATGAAATAGATATGGAAGAATTTGAAGAC
CATATTGATGAGATAGCTGAGTATGAAGAAGACTATCCTAATACTTAGGAAGAAAAACAT
AGACAACTCTTAGATTTCTATATGAATCCCAATTTTAACAAATACGATGTGGTTTGA