Identifiers and Description

Gene Model Identifier

TTHERM_00348200

Standard Name

ULP1 (Ubiquitin-like protease 1)

Aliases

PreTt05232 | 36.m00196 | 3703.m00029

Description

Ulp1 protease family, C-terminal catalytic domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00166 ) ribosomal protein S6
  • ( PF02902 ) Ulp1 protease family, C-terminal catalytic

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00348200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09737.19.997093137033517e-262Ulp1 protease family, C-termin
al catalytic domain-containing
protein (526 aa)
DictyBaseDDB_G02922909.997019043202629e-21DDB_G0292290 on chromosome: 6
position 1396696 to 1399005
SGDYPL020C0.0000000000009003435339752751ULP1 Protease that specificall
y cleaves Smt3p protein conjug
ates; required for cell cycle
progression; associates with n
ucleoporins and may interact w
ith septin rings during teloph
ase; sequestered to the nucleo
lus under stress conditions
WormBaseWBGene000067360.00000000002000577768187062locus:ulp-1 Sentrin-specific
protease status:Confirmed
UniProt:Q09353 protein_id:C
CD72868.1
OxytrichaContig1491.1.g750.000050024383570459175Ulp1 protease family, C-termin
al catalytic domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000153

Sequences

>TTHERM_00348200(coding)
ATGAAATCAAAGTTTTTAGACACTCTTTTTGATAATATTCTAAATTGGTTAGGACCTAAA
AAAAGAAAGCGAGACGATATTTCTATTGGCGAATATGACGGAGAGTATCCAAGGATTCCT
GATCCTTCCAAAAAAGTATTTAAGTCAAGCGATCAATTTAGTTCTTCCAACGATTAGAAA
CTAGCCAATAATAATAATAACAGCAGTAGTGCAAATTAGTCGAGCGATGATGTGCCTTAA
ATCATCCATTCAGTTATTCCTATAAAAAATAATACATCACCTAGAAAGGAAGCATAGTAT
TAACAGATTAATAAGAAAGACATAATAGACCATAATAAAGAAAACTCGAATACGAAAGTA
AAGTTGCAAAACTAACCTAACCCTAAAGTAATTGTGCTCAATGAATGCAATGGGAATTCA
AAAAAAAACGAATTTTAGCTAAATGGAAAGAAGGAAGCATAACTCTAGGAGTTTATTGTG
ATAGAAGAGGATGGAATTGAGTAGGCAAAGTAAAATCATAATTAAGATAAATAATTGTAG
CTAGCTAGAAGACCGTCTTCAGCGCAGTATTAAATTGAATAAGATAGAAAGTAAAGAGAG
AATTTAGATTTGGAAATAATCCAACTCCCAAAAGAATTTATGGAATTCAAAGAAATAACC
GATGAATGGATTTCGAATGACTTTGGTTTGCTCGAATAAAAAATGGCTAAGCTTGACTTA
TAGACATAATAAATAAAATAGAAAACAGAAGAAGGAAGAAAAAAGAATGGCAATAATAAT
TAAGTAGATTCAGACATTATATTTATAAAATAATACCATAAGAAATCAAAAGTTGGAGAA
TTATTAGAGGAATTTAACTAAATTTATGACTTAAAGACTAAAAAGATGAAAAAACTTTTT
TGGAGATTTGAAGAAAAGCAACTTAAAGAAGTTTAGGATGTATTTGAAAGAAGCTTCAAT
TTGAATTAGGATGTAGTAACTCATTAACACATCTTAGAAAGACTTACTTTTAGCAATTTA
TAGACTCTCAGGTAGCCTAATTGGCTTAATGATGAAGTTATCAATGCTTATATAAGATTA
ATAGTGTAATCAACAAATGCAGTCATATTAAATACCTTTTTCTATCCTGAGTTGGTAAAA
AACAGTGCTTGGAATAAAATCAAAAGAATAGCAACTAAAAATAAAGTGACCTATAAATCA
GGAAACTTTTTTGTACCTATGAATATTAATGGAACTCATTGGTCATTTGTTGAAGTAAAT
AATGAAACAAATAAAATCATCTACTATGATTCTCTCGCTACTGATGACAGAGATTATTTT
AATTATACAAAATACTTTGTAGATTTGATGTAAAACTTATAAAAAGACGATGGAATTGCA
TAAGAAAATATTAAAAAATACGAGCTAATAAATGGCGAAACAGGATTCTAATAAAACGGA
TATGATTGTGGAGTATTTATGCTAAAAGGTATACATTACAGATCTTCTGGTATAAATGGC
TTAAGGTTATGGATTGAATAAACAGATACCCAATACTACAGATATTTAATAGCATTTTAG
TTAATTTAAGGAAAAGTAGAGATTTGCTAAAACTGA


>TTHERM_00348200(protein)
MKSKFLDTLFDNILNWLGPKKRKRDDISIGEYDGEYPRIPDPSKKVFKSSDQFSSSNDQK
LANNNNNSSSANQSSDDVPQIIHSVIPIKNNTSPRKEAQYQQINKKDIIDHNKENSNTKV
KLQNQPNPKVIVLNECNGNSKKNEFQLNGKKEAQLQEFIVIEEDGIEQAKQNHNQDKQLQ
LARRPSSAQYQIEQDRKQRENLDLEIIQLPKEFMEFKEITDEWISNDFGLLEQKMAKLDL
QTQQIKQKTEEGRKKNGNNNQVDSDIIFIKQYHKKSKVGELLEEFNQIYDLKTKKMKKLF
WRFEEKQLKEVQDVFERSFNLNQDVVTHQHILERLTFSNLQTLRQPNWLNDEVINAYIRL
IVQSTNAVILNTFFYPELVKNSAWNKIKRIATKNKVTYKSGNFFVPMNINGTHWSFVEVN
NETNKIIYYDSLATDDRDYFNYTKYFVDLMQNLQKDDGIAQENIKKYELINGETGFQQNG
YDCGVFMLKGIHYRSSGINGLRLWIEQTDTQYYRYLIAFQLIQGKVEICQN


>TTHERM_00348200(gene)
ATGAAATCAAAGTTTTTAGACACTCTTTTTGATAATATTCTAAATTGGTTAGGACCTAAA
AAAAGAAAGCGGTAAGCAAAAAGCTTTAAAATTCATAAAAATAAAGGATGATACTATAGG
CATTAAAGTAAAATAATGAAGAGTATTCATTCCTTCATTTCAACTGTAAAAATAGCAATG
ATAGTAGGACATAATTTTAAATTATAATATTAATTAGAGACGATATTTCTATTGGCGAAT
ATGACGGAGAGTATCCAAGGATTCCTGATCCTTCCAAAAAAGTATTTAAGTCAAGCGATC
AATTTAGTTCTTCCAACGATTAGAAACTAGCCAATAATAATAATAACAGCAGTAGTGCAA
ATTAGTCGAGCGATGATGTGCCTTAAATCATCCATTCAGTTATTCCTATAAAAAATAATA
CATCACCTAGAAAGGAAGCATAGTATTAACAGATTAATAAGAAAGACATAATAGACCATA
ATAAAGAAAACTCGAATACGAAAGTAAAGTTGCAAAACTAACCTAACCCTAAAGTAATTG
TGCTCAATGAATGCAATGGGAATTCAAAAAAAAACGAATTTTAGCTAAATGGAAAGAAGG
AAGCATAACTCTAGGAGTTTATTGTGATAGAAGAGGATGGAATTGAGTAGGCAAAGTAAA
ATCATAATTAAGGTATCTTTTAATAATCTTAATAATAAAAATATAATAACAATAAATATT
AATAGATAGAAGTAGTTTTTATACTAATAAATAACTAAAAAAAACAAAAAAATAATAATT
TATAATTTGATTTTCTATTATTTATTGATTGAAGTAGTCATTCATATTTTAATTAAAAAA
TTGTAGATAAATAATTGTAGCTAGCTAGAAGACCGTCTTCAGCGCAGTATTAAATTGAAT
AAGATAGAAAGTAAAGAGAGAATTTAGATTTGGAAATAATCCAACTCCCAAAAGAATTTA
TGGAATTCAAAGAAATAACCGATGAATGGATTTCGAATGACTTTGGTTTGCTCGAATAAA
AAATGGCTAAGCTTGACTTATAGACATAATAAATAAAATGTAAATAAGAAATTATTTTGC
AATGATTTTAGTAATGAAAAATAAAATTAAAAGAGAAAACAGAAGAAGGAAGAAAAAAGA
ATGGCAATAATAATTAAGTAGATTCAGACATTATATTTATAAAATAATACCATAAGAAAT
CGTAATTTTTAGCATTTCTATTTTCTTTTTATAGAGCATAATTCATTCATTTATTTTTTA
AATTACAGAAAAGTTGGAGAATTATTAGAGGAATTTAACTAAATTTATGACTTAAAGACT
AAAAAGATGAAAAAACTTTTTTGGAGATTTGAAGAAAAGCAACTTAAAGAAGTTTAGGAT
GTATTTGAAAGAAGCTTCAATTTGAATTAGGATGTAGTAACTCATTAACACATCTTAGAA
AGACTTACTTTTAGCAATTTATAGACTCTCAGGTAGCCTAATTGGCTTAATGATGAAGTT
ATCAATGCTTATATAAGATTAATAGTGTAATCAACAAATGCAGTCATATTAAATACCTTT
TTCTATCCTGAGTTGGTAAAAAACAGTGCTTGGAATAAAATCAAAAGAATAGCAACTAAA
AATAAAGTAAACTATAATAAATACACTATTTTTTGAAAACTTTAATCTATATATAATTAA
AAAGGTGACCTATAAATCAGGAAACTTTTTTGTACCTATGAATATTAATGGAACTCATTG
GTCATTTGTTGAAGTAAATAATGAAACAAATAAAATCATCTACTATGATTCTCTCGCTAC
TGATGACAGAGATTATTTTAATTATACAAAATACTTTGTAGATTTGATGTAAAACTTATA
AAAAGACGATGGAATTGCATAAGAAAATATTAAAAAATACGAGCTAATAAATGGCGAAAC
AGGATTCTAATAAAACGGATATGATTGTGGAGTATTTATGCTAAAAGGTATACATTACAG
ATCTTCTGGTATAAATGGCTTAAGGTTATGGATTGAATAAACAGATACCCAATACTACAG
ATATTTAATAGCATTTTAGTTAATTTAAGGAAAAGTAGAGATTTGCTAAAACTGA