Identifiers and Description

Gene Model Identifier

TTHERM_00193860

Standard Name

UFM1 (ubiquitin fold modifier 1)

Aliases

PreTt06670 | 16.m00326

Description

UFM1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03671 ) Uncharacterised protein family (UPF0185)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00193860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig7751.0.g119.002473480287786e-47Ubiquitin fold modifier 1 prot
ein
WormBaseWBGene000443242.9993743585281133e-40locus:ufm-1 Ubiquitin-fold m
odifier 1 status:Confirmed
UniProt:P34661 protein_id:C
CD62548.1
DictyBaseDDB_G02957099.00381557957642e-37ufm1 on chromosome: 6 position
620919 to 621509
Tetrahymena borealisEI9_03661.14.9988726541653934e-26hypothetical protein (48 aa)
Stentor CoeruleusSteCoe_270696.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00193860(coding)
ATGGCCACTAAGCAAAAAGTTACTTTCAAGATCACTTTGACTTCTGATCCTAATCTCCCT
TTCAGAACTATTAGCGTTCCAGAAGAAGCTCCTTTTTCAGCTTGCATTAAATATGTTGCT
GAACAATTTAAAGTAAATCACGCAACTTCAGCCATTATTACTAGCACTGGTGTTGGTATT
AACCCTGAGCAAACAGCAGGAAATGTTTTCCTTAAGCACGGAAGTGAATTAAAATTAATC
CCTAGAGATAGAGTAGGAAATTAATGA


>TTHERM_00193860(protein)
MATKQKVTFKITLTSDPNLPFRTISVPEEAPFSACIKYVAEQFKVNHATSAIITSTGVGI
NPEQTAGNVFLKHGSELKLIPRDRVGNQ


>TTHERM_00193860(gene)
ATGGCCACTAAGCAAAAAGTTACTTTCAAGATCACTTTGACTTCTGATCCTAATCTCCCT
TTCAGAACGTATTTTTAATTAATCATTATTATTTAAAAAAAGAAAAAGATTACTTTACGC
AATTTTAATTTACATTTTCTTTCGTATAATAATTTAGTATTAGCGTTCCAGAAGAAGCTC
CTTTTTCAGCTTGCATTAAATATGTTGCTGAACAAGTAAGATATTATAAATAAAGGAAGA
TCAGTTGTTTAATATTTATTCAATAAAATTAAAGTTTAAAGTAAATCACGCAACTTCAGC
CATTATTACTAGCACTGGTGTTGGTATTAACCCTGAGCAAACAGCAGGTAATATTTAAAA
TAAAAATAAGCTATTTCATAAAATAAAAAATAAAATAAATAATAGGAAATGTTTTCCTTA
AGCACGGAAGTGAATTAAAATTAATCCCTAGAGATAGAGTAGGAAATTAATGA