Identifiers and Description

Gene Model Identifier

TTHERM_00355130

Standard Name

UFD1 (ubiquitin fusion degradation 1)

Aliases

PreTt27499 | 37.m00216 | 3836.m02303

Description

ubiquitin fusion degradation UFD1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00165 ) ribosomal protein S18
  • ( PF03152 ) Ubiquitin fusion degradation protein UFD1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00355130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02314.19.997093137033517e-262ubiquitin fusion degradation p
rotein UFD1 containing protein
(305 aa)
OxytrichaContig726.1.g1161.9992362000979228e-56Ubiquitin fusion degradation p
rotein UFD1
DictyBaseDDB_G02711224.001501063932074e-49ufd1 on chromosome: 2 position
33552 to 34772
SGDYGR048W1.9991939848149086e-44UFD1 Protein that interacts wi
th Cdc48p and Npl4p, involved
in recognition of polyubiquiti
nated proteins and their prese
ntation to the 26S proteasome
for degradation; involved in t
ransporting proteins from the
ER to the cytosol
WormBaseWBGene000067331.9993430003514377e-39locus:ufd-1 Ubiquitin fusion
degradation protein 1 homolog
status:Confirmed UniProt:
Q19584 protein_id:CAA93460.1
Stentor CoeruleusSteCoe_170041.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00355130(coding)
ATGGACTTCATCAATTAATTAATTGGCGGCCGCGGTGGCGGTGGTAATTATAATCAATAA
TACTACGCCTATAATAATAGAAAGCCTTAGTATTCAGATCATTTGGAAGTTTATCCAGCT
TATATGCTAGAAAGACATGATTTAGAAAAGGGAAATAAGATTTTGTTGCCACCTTCTGTT
TTAAATACTCTTTCAGCATCTAACTTACCCTATCCTATGATTTTTTGTGTATAAAATACC
TATTTAAATAAGCAGACATATGTAGGTGTGTTGGAATTTATAGCTCCTGAAGGTACTTGC
TACATTCCATTTTGGATGTTTTAGATGTTATAATGCTTTGATGGGTAATAAATTTAGGTA
ACTCTTGTCACTGATGTAAAAAAAGGAAAATTCGTAAAAATTTAGCCACACGAAACTGCC
TTTATAGATTTACCTGATCCTAGAGCTATCCTTGAAAAAGAATTAAGAAACTATACAGTT
TTGCATTAAGGAGATACAATTCACATAGAATTTATGAAATAGCATTTTTAGATTGATATT
TTAGAAGTAAAACCTGCTAATGATTATAATGCAATTTGTGTCGTTGATGCAGAAATCGAA
GTAGATTTCGCTAAGCCTTTGGATTATGTAGAGCATCCCTTGCCAACTATGACCAAAAAG
GAATCAAGTGTTGTCATGGGTGAAGAAAATTAGCCTAAATAGGAGAAAAATCCTTTCAGT
GGAAAGGCTACTAGAATAGATGGTAAAGCTATTGATTAAAAGAAGTTAAAAATGAAAGAA
GAAGTAAAGGAAGATTACGATCCTAGAAAGCATAGACTACCTAACGGTGTTAGAAGAAAA
ATACTTAATAACGAATTCGTTGGTAAATCAACTGTTATTGGAAAGTCTATGTCTACTATG
AATAAAAAAAAATGA


>TTHERM_00355130(protein)
MDFINQLIGGRGGGGNYNQQYYAYNNRKPQYSDHLEVYPAYMLERHDLEKGNKILLPPSV
LNTLSASNLPYPMIFCVQNTYLNKQTYVGVLEFIAPEGTCYIPFWMFQMLQCFDGQQIQV
TLVTDVKKGKFVKIQPHETAFIDLPDPRAILEKELRNYTVLHQGDTIHIEFMKQHFQIDI
LEVKPANDYNAICVVDAEIEVDFAKPLDYVEHPLPTMTKKESSVVMGEENQPKQEKNPFS
GKATRIDGKAIDQKKLKMKEEVKEDYDPRKHRLPNGVRRKILNNEFVGKSTVIGKSMSTM
NKKK


>TTHERM_00355130(gene)
ATGGACTTCATCAATTAATTAATTGGCGGCCGCGGTGGCGGTGGTAATTATAATCAATAA
TACTACGCCTATAATAATAGAAAGCCTTAGTATTCAGATCATTTGGAAGTTTATCCAGCT
TATATGCTAGAAAGACATGATTTAGAAAAGGGAAATAAGATTTTGTTGCCACCTTCTGTT
TTAAATACTCTTTCAGCATCTAACTTACCCTATCCTATGATTTTTTGTGTATAAAATACC
TATTTAAATAAGCAGACATATGTAGGTGTGTTGGAATTTATAGCTCCTGAAGGTACTTGC
TACATTCCATTTTGGATGTTTTAGATGTTATAATGCTTTGATGGGTAATAAATTTAGGTA
ACTCTTGTCACTGATGTAAAAAAAGGAAAATTCGTAAAAATTTAGCCACACGAAACTGCC
TTTATAGATTTACCTGATCCTAGAGCTATCCTTGAAAAAGAATTAAGAAACTATACAGTT
TTGCATTAAGGAGATACAATTCACATAGAATTTATGAAATAGCATTTTTAGATTGATATT
TTAGAAGTAAAACCTGCTAATGATTATAATGCAATTTGTGTCGTTGATGCAGAAATCGAA
GTAGATTTCGCTAAGCCTTTGGTATTTATTTGAATTTCTTATTAAATAATGTGCTTTTAG
ATTTTTAAACAAATGCATAAAAGCAATAATAGAAAAAAAGAAAGTTAATTTTAAATAAAT
TTTTTTATTTTTAATAAAGGATTATGTAGAGCATCCCTTGCCAACTATGACCAAAAAGGA
ATCAAGTGTTGTCATGGGTGAAGAAAATTAGCCTAAATAGGAGAAAAATCCTTTCAGTGG
AAAGGCTACTAGAATAGATGGTAAAGCTATTGATTAAAAGAAGTTAAAAATGAAAGAAGA
AGTAAAGGAAGATTACGATCCTAGAAAGCATAGACTACCTAACGGTGTTAGAAGAAAAAT
ACTTAATAACGAATTCGTTGGTAAATCAACTGTTATTGGAAAGTCTATGTCTACTATGAA
TAAAAAAAAATGA