Identifiers and Description

Gene Model Identifier

TTHERM_00674500

Standard Name

UDH8 (UvrD/REP-family DNA helicase 8)

Aliases

PreTt10990 | 101.m00145

Description

UDH8 UvrD/REP helicase family protein; UvrD/REP-family DNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00674500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.12.998990600740728e-62UvrD/REP helicase (1047 aa)
SGDYOL095C0.0000009995106777214876HMI1 Mitochondrial inner membr
ane localized ATP-dependent DN
A helicase, required for the m
aintenance of the mitochondria
l genome; not required for mit
ochondrial transcription; has
homology to E. coli helicase u
vrD
OxytrichaContig981.0.0.g230.000030009396760408108UvrD/REP helicase N-terminal d
omain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00674500(coding)
ATGTAGTAACTCAAGAGTGATTTAGATCGTTTTACTGACGATTAAAAGAAGTTTATTTTA
TCTCCAAAAAATGTAGATATCAAAGTCAATGCTTGCGCTGGATCTGGAAAAACTGAATGC
ATTCTTTAATTTGTAAAATAGGCTAGATTGAGTGGAATTAATTATAAGCAAATTTGCATT
ACTACGTTTAACATCTAAGCAATAAATGATATACATAAAAGAGCAGTCGATTTATTTGGT
GAAGAATTAGCTGATGAGATAGAAATTAAAAACTTTGATAAATTAATAACTAAATCTTAT
GAATCAATCAAAACTTTATAAAATCCTTAACAAAAAGATATTTTTACAGAAGAGGTAGAT
ATTACCTTAGTTGAAAAATAATTTGAGCTAGTGAACATGGATTACTAAAATTTAGGTAAG
GATGATAAAATGTAAATCTTTGGCGCATATAAAATAATTATTTTTGATGAATTTTAAGAT
ATTAATGAACTTTAATACAGCTTTTTATTGCTATTCAAAAAATATGGAGGATCAAACATC
GTTGTAGTTGGAGATGCATCGCGATTATTCAAAAATATAAGCAAAGAATCATATTCTAAG
GATGAAAATGTTATAATAGAAGAAGATGATGACAAATTCTATGAAGAGAAATAAAATAAT
AAAAAATTTTCATATAGAATTAGTGATTTTTTTGATAATTTAAGCAATATTTAGTATATC
AATCATCTAAAATAATCCTAATAATATCTTAAAGATATTTATGTCAGCGAAATAGAAATA
TTCAATAAATAGCATACTCTTAGCGAATAATAGATACAATTGATATTTTCAGAATAGTAA
CAAAACTTGCTATTCAATTACATATAAATAATTCTTTTAGAAAAAAGTAAGAAATAAGTT
TAGCTCACTAAAGAAGCTTACTATTTATAGAAAATAAAATAGAAAATATAAAATTTATAA
GAACATAATTACCTATAAAATATGCTTAAATTATTCAAAGACAATAATTAATCTTTAGAG
AGAAATCAAAAAGAGCTTTATGAAGCTATTTATAAAGCATGTATCTTTTTAGAAGTAAAA
AAATCAAATTAGTTTAAATATATTTTCTACCAAGATCCCTATAAAGAATAAGAAAAAATC
ATAAACTGCTTAAAGAAAATGTTGGATACTTGTTTTAAAAAGTAAGATTATTAAGATCTC
CTTATTTAAGATTATATTGAAAAAGATAAATTTTATGATTATGAAACCTTCTCAAGTAAA
GACACAATCTATGAAATCATATAATCTTTTGAAAAACAAACAGTTGGAAAATAAGTTATG
CTAACAGTTTTAGGGAAAATATCTATCCTTAAAGTAAAATATTAGAGAGATATTAAAAAT
ATATTATTCTACAATCCGATATAAGGAACGTCTGTCAAATACTCTCTATCTAATTGGAAT
TTTCATGATCAATTTATTTCATATATGGAAGATATTATAAAATAAGAAAGTGATTAAAAT
AACTTGAATTAATGTTCAAGTTAATCCTTTTAAAATGTATCAAATATTTAGAAAAAAAAA
GATGAATAGAATTCTAGTATCAATATAAAATTAAATTAAATTCAGCAGGAAATAAGTTCG
TCTAAATTTAAAGATTAGGTTTAAAATAAAAACAATTTAATCATAGACTTAGAATAATCA
CCAACCGTTTTAGATTATAACTAAAAAAAGGGGAAATTAATACATGCTGCTCCATTTTAA
TAAGAACCTGGTCTTTCTAAAAGGCTTCATTTTGAACAGGATGAATCTTTCGGTTTAAGA
AACTGA


>TTHERM_00674500(protein)
MQQLKSDLDRFTDDQKKFILSPKNVDIKVNACAGSGKTECILQFVKQARLSGINYKQICI
TTFNIQAINDIHKRAVDLFGEELADEIEIKNFDKLITKSYESIKTLQNPQQKDIFTEEVD
ITLVEKQFELVNMDYQNLGKDDKMQIFGAYKIIIFDEFQDINELQYSFLLLFKKYGGSNI
VVVGDASRLFKNISKESYSKDENVIIEEDDDKFYEEKQNNKKFSYRISDFFDNLSNIQYI
NHLKQSQQYLKDIYVSEIEIFNKQHTLSEQQIQLIFSEQQQNLLFNYIQIILLEKSKKQV
QLTKEAYYLQKIKQKIQNLQEHNYLQNMLKLFKDNNQSLERNQKELYEAIYKACIFLEVK
KSNQFKYIFYQDPYKEQEKIINCLKKMLDTCFKKQDYQDLLIQDYIEKDKFYDYETFSSK
DTIYEIIQSFEKQTVGKQVMLTVLGKISILKVKYQRDIKNILFYNPIQGTSVKYSLSNWN
FHDQFISYMEDIIKQESDQNNLNQCSSQSFQNVSNIQKKKDEQNSSINIKLNQIQQEISS
SKFKDQVQNKNNLIIDLEQSPTVLDYNQKKGKLIHAAPFQQEPGLSKRLHFEQDESFGLR
N


>TTHERM_00674500(gene)
ATGTAGTAACTCAAGAGTGATTTAGATCGTTTTACTGACGATTAAAAGAAGTTTATTTTA
TCTCCAAAAAATGTAGATATCAAAGTCAATGCTTGCGCTGGATCTGGAAAAACTGAATGC
ATTCTTTAATTTGTAAAATAGGCTAGATTGAGTGGAATTAATTATAAGCAAATTTGCATT
ACTACGTTTAACATCTAAGCAATAAATGATATACATAAAAGAGCAGTCGATTTATTTGGT
GAAGAATTAGCTGATGAGATAGAAATTAAAAACTTTGATAAATTAATAACTAAATCTTAT
GAATCAATCAAAACTTTATAAAATCCTTAACAAAAAGATATTTTTACAGAAGAGGTAGAT
ATTACCTTAGTTGAAAAATAATTTGAGCTAGTGAACATGGATTACTAAAATTTAGGTAAG
GATGATAAAATGTAAATCTTTGGCGCATATAAAATAATTATTTTTGATGAATTTTAAGAT
ATTAATGAACTTTAATACAGCTTTTTATTGCTATTCAAAAAATATGGAGGATCAAACATC
GTTGTAGTTGGTAATTAATAAATTTATTTATTAACTCATTTGAAATTTATTCTTAATTAT
TTAATTTATTAATTAGGAGATGTATTTTAAAATATTTATCAATTTAGAGGATCAGATTAA
AAATATTTGAGTAATCAAATTAATCAAGACATTCAAAGTATAAACTAAAATTTGAAAAAG
AGGGATTAAAAAATTATAGATCTTAGTTTATCTATAAACTTTAGATGTTCCTAGGAAATA
ACTTTTTTTGCAAATGAAATAATTAAATGCTAAAATGAGAATTCAAATTTAATGAAATCC
TTTTAAGGTAAATTTATTTTTTCTTTCTTTTTCGCAACAAATTTTAGAAATCTCATCATA
TTTTTAGAGTTGAATAATTCAAACAATGAAATTAAGAAGAAGTAGATTCCTTTTTTAGAA
GGTTTTATGAGTAATAAAGATTAATTTAAAAGTATTGTCAAATCAATAAATACTTACATT
GAAGAAGGATATTCATATGACGATATAGCTATAATTAGTCCAATTTAAGCATCTCTTAAG
GAAATAGAGTACCTTATTGAAGAACAAAATCATAAAATAAAATAAAACCCAGACAAAAAT
AAAGATAAAAAGATAATACCTTATTACAGTGTAATAGGAGATAGTTCTAATTTTGATTGT
AAGCATCAATTTAAATAAAAAAATAAAATTTCGCTGTCAACTGTCCATAGAGCAAAAGGA
TTAGAATGGAAAATAGTATTCTTTATTGGATTGAATGATGATGTAATTCCTATGTCATTT
TTAAGATAAGGTGACTTGAAATAGAAAATGGAAGAAATGAGGCGTCTATTTTATGTTGGA
TGCACAAGATCTGCAGAAATACTGAAAATGTTCTATTTTTGTAATAATTAAAGAAAAGTA
ATTTCTTATTTCTTTAAAAAAAAATATTATAACAACTTATTAAAATTTTTAGGCATCGCG
ATTATTCAAAAATATAAGCAAAGAATCATATTCTAAGGATGAAAATGTTATAATAGAAGA
AGATGATGACAAATTCTATGAAGAGAAATAAAATAATAAAAAATTTTCATATAGAATTAG
TGATTTTTTTGATAATTTAAGCAATATTTAGTATATCAATCATCTAAAATAATCCTAATA
ATATCTTAAAGATATTTATGTCAGCGAAATAGAAATATTCAATAAATAGCATACTCTTAG
CGAATAATAGATACAATTGATATTTTCAGAATAGTAACAAAACTTGCTATTCAATTACAT
ATAAATGTAAATTTTTATTCTTTCTTTACTCTATTTTTATTTTATTATAATCTATACATT
TTTAACTGATTTTTAATCACATACATTTGAGATTAATTGAAAGATATTATTTATAAATTC
TATAGAAATTCATCCAAAAATATTTAAATTTTTGAATTTTGCAATCAAAAAGTTAATTAA
TTTTAAAAATACTAAATTACTCTAATTAAGTGCACCCCAAAAAAACACTTCGAATTTTTA
AGATATATTAAAAAAAGTTTTTAAAAAAGGCTAAAATTAATTAAAAATTTAATAAAAAAA
TCATATAGATTGATATAAATTAAAATTTAAATAAATATTATTAATGAAATTCTATTAGAA
AATTATTTATTTTTTTTGTAAATAATTTTCAAGCACATTAGCCATTCAAAAAAATAGTGA
TTTCAATTCACTAAATTTTTGAATGGCATTTGGCTATACCTTAAAATATTATAAGTTCAT
TCTTTGATTAATATTTTAAGTAAACACTTAAAAAATATAATAAGATTTACTCTCATAATT
GAAAATTATAAAAATTTATTTTATTTATTTATCATATTAATGATTAAAAATTAAATAATA
TAAAGCATGCTTTTTAGAATTCTTTTAGAAAAAAGTAAGAAATAAGTTTAGCTCACTAAA
GAAGCTTACTATTTATAGAAAATAAAATAGAAAATATAAAATTTATAAGAACATAATTAC
CTATAAAATATGCTTAAATTATTCAAAGACAATAATTAATCTTTAGAGAGAAATCAAAAA
GAGCTTTATGAAGCTATTTATAAAGCATGTATCTTTTTAGAAGTAAAAAAATCAAATTAG
TTTAAATATATTTTCTACCAAGATCCCTATAAAGAATAAGAAAAAATCATAAACTGCTTA
AAGAAAATGTTGGATACTTGTTTTAAAAAGTAAGATTATTAAGATCTCCTTATTTAAGAT
TATATTGAAAAAGATAAATTTTATGATTATGAAACCTTCTCAAGTAAAGACACAATCTAT
GAAATCATATAATCTTTTGAAAAACAAACAGTTGGAAAATAAGTTATGCTAACAGTATTT
ATTTATTTATTCGATTTTTGTTTGATTTACTTATTAATTAATTCATTCATTTAATTTTCT
TTTACTTTAAAAGGTTTTAGGGAAAATATCTATCCTTAAAGTAAAATATTAGAGAGATAT
TAAAAATATATTATTCTACAATCCGATATAAGGAACGTCTGTCAAATACTCTCTATCTAA
TTGGAATTTTCATGATCAATTTATTTCATATATGGAAGATATTATAAAATAAGAAAGTGA
TTAAAATAACTTGAATTAATGTTCAAGTTAATCCTTTTAAAATGTATCAAATATTTAGAA
AAAAAAAGATGAATAGAATTCTAGTATCAATATAAAATTAAATTAAATTCAGCAGGAAAT
AAGTTCGTCTAAATTTAAAGATTAGGTTTAAAATAAAAACAATTTAATCATAGACTTAGA
ATAATCACCAACCGTTTTAGATTATAACTAAAAAAAGGGGAAATTAATACATGCTGCTCC
ATTTTAATAAGAACCTGGTCTTTCTAAAAGGCTTCATTTTGAACAGGATGAATCTTTCGG
TTTAAGAAACTGA