Identifiers and Description

Gene Model Identifier

TTHERM_00128650

Standard Name

UDH6 (UvrD/REP-family DNA helicase 6)

Aliases

PreTt09429 | 9.m00450 | 3699.m00158

Description

UvrD/REP-family DNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00036 ) EF hand
  • ( PF00580 ) UvrD/REP helicase
  • ( TIGR01075 ) DNA helicase II
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01074 ) ATP-dependent DNA helicase Rep
  • ( TIGR01073 ) ATP-dependent DNA helicase PcrA
  • ( PF01443 ) Viral (Superfamily 1) RNA helicase
  • ( PF07492 ) Neutral trehalase Ca2+ binding domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00128650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.18.99652583192316e-145UvrD/REP helicase (1047 aa)
SGDYJL092W0.00000005999527666938375SRS2 DNA helicase and DNA-depe
ndent ATPase involved in DNA r
epair, needed for proper timin
g of commitment to meiotic rec
ombination and transition from
Meiosis I to II; blocks trinu
cleotide repeat expansion; aff
ects genome stability
OxytrichaContig14871.0.0.g770.000005000363240844623UvrD-like helicase C-terminal
domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00128650(coding)
ATGGAATAACAGGTTTCAGATGAGAATAGCTGTTAAGAAAACATAGCATTAACTGATGAA
TAAAAAAAAATAATTAATTCCTCAATCGATGAAGATCAAAGAATTTTAGCATGTGCAGGT
TCAGGTAAAACAACTACACTCATTTATCGAATCAAGTATTTGATTGAATAAGGAATATGT
GCTAAATAAATACTACTAAGTACTTTTAATGTTGAAGCTGCTAATAACTTAAAAATAAAA
GCAAAACAAGTGTTATAGTAAGATGCAGAAGAAGTAAAAATGATGAATATAGATAAATTT
AATGCTGAAATTTATAACAAATATATAAAAGATAATGATAAAGATAATAACTTTAAATTA
GATATAAAAGAGTTAGGATATAAAGTTTAACAATTCTTAAGTACAAGAGAAGGAAATGAA
AAGGTTTTAAAGAAATATAAATACTTTTTTTTTGATGAGTTTTAAGATGTAAATCAAATC
TAGTATGACATCCTAATTCTTTTCAAAAAAGCAGGATGCAAAATTATAGTTATAGGAGAT
GAGGCTTAAAATATTTACAGCTTTAGAGATTCTAAATTAGAATTTATTCAAAGCAAAATA
AACTAAGATGTGCTAGAAATCTCAAAATAGGAAATAAAAACATATCACCTTAGTGTAAAT
TTTAGATGTTCAAGAAAAATCACATCATTTTGCAATTAAATTTTTGCAAACTAGAAGCAT
CTTGCAAGGCCTATGGATAGCTTAAAAAATGAAGAAGAGGAATGTTATTATCCTAAAATT
AGCCTTTATGGAGATTAAAATAAATAAGTGTATGATTTAATTTCAACTTTTAAAGGTTTA
ATATAGTAGGGGTATTAGTGGAGTGATTTGGCAGTACTTAGTCCTTCAAGAAAACCATTA
CTACACTTTTAGGAGTATTTAGAATAGCATTATTATATTTTTGGCCAAAAAATTCCTTAT
TCCCTAATATCCAGAAATATAGATAATCTTTTCACTTCTGATAATTTTGAATCTACTGAG
AAGTAAAATCACTTGACTTTGAGCACAATCCATTCTTCTAAGGGTTTGGAATGGAAGGTA
GTATTTATAATTGGAATTAATGATTTTAATTTTCCAGGAGCTTTCATCAAGTAGTTATAA
GTAGAAAAAAATATTTAAGAAAAGTTAAATGAGTGTAGAAGATTATTCTATGTAGCGTGC
ACTAGAGCTATGGAATAGCTAAAGTTTTGTTTCTTATAATATAAAGAAAAATATATATGT
AGGTTTTTCAGTGAAATTAATAAATAATATTACTAATCAGATCAAGATTTAAAAAAAGAA
GATTTTGCTTAAATCCAATCAAAATAAAAAAACTAAGTTTAACAAAGAAATTTATAAAAT
CCTTCCTAAAAAAAATCAACAATTGAAGCATTAGATATCAAAAATAAAATAGCTGATATC
ATACAAAATTTTGACATTAATGACTATGAAGTACTGAACAGTTTTCTATAAAAAATAAAA
CTTCTTAAATATTAAAGAGGGGAACATGTCACTTTCGACAATGAATAAATAAAATAAAAC
GCTCTTTAATAAGATTTGATTTGCTATCTTGAAATATTACTTTATAGAAGTGTTGTTGAA
AAATTCTTGTAAAGCTAGACAATTTAAAATGAAGATGCAGAGAAAATAATACTACGTACA
ATAAGTTGGAGTGGATATTAAAAGAGTTTTTATAATAGATACAAAGATTTCTTCAACTAA
TTAGATTTTCAAAAATTAGACAGCCTTGAGTCATTTATAGACAATTTCAAAGACTTTAAC
AAAATCGAAAAGAAATTAAATAGATTTGAAAATGAGAATTTATCGGATATGTACTCATCA
ATTTAAAAATTTTTAAAACAGTATAAGCTAAATTATAAAGATATTCATCATGCAACTGAA
ACTTATTTTTCAGATGATTTTGATAGGTAGAAATATTTTGACAGTTATTAACAATTTTCA
AATAAAGAATTGAAAACCTAAAATATTCTCAAAGACATTTATAATGTCAGTAAATTTAGT
TTAATTTCCTAAGGAATAAAGAGATCTTTATACAGAGATGATAGTAGTTTATTTCATAAT
GAGGATTTAACATTAAATATAGATAGATTTTTAAATGTCCTAGAATAATAATATGATTAG
AATAGGTTTGAAATAAAAAAGAAAATAAATTATGCTAATTTTTATGGGGTTATAGATTTA
ATAGCATTTGATAAATCTCTAGCTTATGCATGTATATTAAAAAAAATGAATTACAGGATA
CAAAATATTGTTTTCTATAATGTACTTCAAGATAATTGGATCATTTATTCGATAGAGTAA
TGGAATTAAGAAGAAGAATTCTTAAGATTTTTGTAAAAGAAAAAAGAAGATTACTAAAAA
GAGTAAGAAGAGAGTGAGGAGACTGATAATAATTTAGAGAAAGAGAAGTAATAGTAAGTA
AAAATCTAAGAGAAATCTTTGTAAAACTTATAAGTTCCTATTGAAGAATAAGAAAAAGAG
AATAATAGTAAGAATATTAATAATTATAGTCTACAAGAAAGTTAATAGGAAAAGAAAAAT
TAACTTATTTATCAAATTAATTGTCAATATTCTCAAAATTCAATTTAAAATTAAAGTTAA
AATTCTGATTAGACTGTATAAGAAAACAATCTTTAACATATGTACAAACAAAATGATTAA
TAAGGCAATATTGACATAGAAAATTAATTTAATTTTGGTAATTAAAGTAAGTAAAATGAT
AATTTAATACAAGTAGCTTTTGATAACTAAAAAATTAACCAAAATGAACCATTAGAAAAT
AAAAATAATTTATTTGGCAATTTTCAATAAATTAGAGATGACACCAAGAAAATTGAAGAG
CCTCGTTAATAATTAATTAATTTAAAAAATCATGTAGGAGAGAACTCTTAAGTTTTAGTA
AATAGCAATTAGAAAGGACTAAAAAAATCTAAAGTTGAAAACTAGAAAATTAATTTGAAC
TAAAAAAGGAAGAAAGAGAAGGATTAAGTTGATTATGAATAGTAGAAAATCAATTTTAAA
AAACAAAAAGTAGAATAAGGAGAGAAATCTATTTTCAATATCTAGATAATATTTTTAATA
ATTTACATATTATTTTAAATCATTAGAACTACATTAAAAAACAAGGAAATAAACTCATGA


>TTHERM_00128650(protein)
MEQQVSDENSCQENIALTDEQKKIINSSIDEDQRILACAGSGKTTTLIYRIKYLIEQGIC
AKQILLSTFNVEAANNLKIKAKQVLQQDAEEVKMMNIDKFNAEIYNKYIKDNDKDNNFKL
DIKELGYKVQQFLSTREGNEKVLKKYKYFFFDEFQDVNQIQYDILILFKKAGCKIIVIGD
EAQNIYSFRDSKLEFIQSKINQDVLEISKQEIKTYHLSVNFRCSRKITSFCNQIFANQKH
LARPMDSLKNEEEECYYPKISLYGDQNKQVYDLISTFKGLIQQGYQWSDLAVLSPSRKPL
LHFQEYLEQHYYIFGQKIPYSLISRNIDNLFTSDNFESTEKQNHLTLSTIHSSKGLEWKV
VFIIGINDFNFPGAFIKQLQVEKNIQEKLNECRRLFYVACTRAMEQLKFCFLQYKEKYIC
RFFSEINKQYYQSDQDLKKEDFAQIQSKQKNQVQQRNLQNPSQKKSTIEALDIKNKIADI
IQNFDINDYEVLNSFLQKIKLLKYQRGEHVTFDNEQIKQNALQQDLICYLEILLYRSVVE
KFLQSQTIQNEDAEKIILRTISWSGYQKSFYNRYKDFFNQLDFQKLDSLESFIDNFKDFN
KIEKKLNRFENENLSDMYSSIQKFLKQYKLNYKDIHHATETYFSDDFDRQKYFDSYQQFS
NKELKTQNILKDIYNVSKFSLISQGIKRSLYRDDSSLFHNEDLTLNIDRFLNVLEQQYDQ
NRFEIKKKINYANFYGVIDLIAFDKSLAYACILKKMNYRIQNIVFYNVLQDNWIIYSIEQ
WNQEEEFLRFLQKKKEDYQKEQEESEETDNNLEKEKQQQVKIQEKSLQNLQVPIEEQEKE
NNSKNINNYSLQESQQEKKNQLIYQINCQYSQNSIQNQSQNSDQTVQENNLQHMYKQNDQ
QGNIDIENQFNFGNQSKQNDNLIQVAFDNQKINQNEPLENKNNLFGNFQQIRDDTKKIEE
PRQQLINLKNHVGENSQVLVNSNQKGLKKSKVENQKINLNQKRKKEKDQVDYEQQKINFK
KQKVEQGEKSIFNIQIIFLIIYILFQIIRTTLKNKEINS


>TTHERM_00128650(gene)
ATGGAATAACAGGTTTCAGATGAGAATAGCTGTTAAGAAAACATAGCATTAACTGATGAA
TAAAAAAAAATAATTAATTCCTCAATCGATGAAGATCAAAGAATTTTAGCATGTGCAGGT
TCAGGTAAAACAACTACACTCATTTATCGAATCAAGTATTTGATTGAATAAGGAATATGT
GCTAAATAAATACTACTAAGTACTTTTAATGTTGAAGCTGCTAATAACTTAAAAATAAAA
GCAAAACAAGTGTTATAGTAAGATGCAGAAGAAGTAAAAATGATGAATATAGATAAATTT
AATGCTGAAATTTATAACAAATATATAAAAGATAATGATAAAGATAATAACTTTAAATTA
GATATAAAAGAGTTAGGATATAAAGTTTAACAATTCTTAAGTACAAGAGAAGGAAATGAA
AAGGTTTTAAAGAAATATAAATACTTTTTTTTTGATGAGTTTTAAGATGTAAATCAAATC
TAGTATGACATCCTAATTCTTTTCAAAAAAGCAGGATGCAAAATTATAGTTATAGGTATT
GTTTGTTTTACTTCTACTTTCTTATTAAATTAAGCTAATTTCTAAAATTATTTTTTTTAG
CATTGTTTTAATATTTCTTATTTAAAATAGGAGATGAGGCTTAAAATATTTACAGCTTTA
GAGATTCTAAATTAGAATTTATTCAAAGCAAAATAAACTAAGATGTGCTAGAAATCTCAA
AATAGGAAATAAAAACATATCACCTTAGTGTAAATTTTAGATGTTCAAGAAAAATCACAT
CATTTTGCAATTAAATTTTTGCAAACTAGAAGCATCTTGCAAGGCCTATGGATAGCTTAA
AAAATGGTAAAGCTCACAAAGCTAAATTATTAAAATAATCATGTTTTTATTTTAATTTAA
ATTGTGTTCATATTTTAAATATTAAAGTTAATTAAATATACAAATTCTTTACATAATTAA
TTAATTAATTAATTAATCATCTTTTACTACTTTAGTTAAATTTAAAAATGTTCAACTTTT
TTTTATAAATAACAGAAGAAGAGGAATGTTATTATCCTAAAATTAGCCTTTATGGAGATT
AAAATAAATAAGTGTATGATTTAATTTCAACTTTTAAAGGTTTAATATAGTAGGGGTATT
AGTGGAGTGATTTGGCAGTACTTAGTCCTTCAAGAAAACCATTACTACACTTTTAGGAGT
ATTTAGAATAGCATTATTATATTTTTGGCCAAAAAATTCCTTATTCCCTAATATCCAGAA
ATATAGATAATCTTTTCACTTCTGATAATTTTGAATCTACTGAGAAGTAAAATCACTTGA
CTTTGAGCACAATCCATTCTTCTAAGGGTTTGGAATGGAAGGTAGTATTTATAATTGGAA
TTAATGATTTTAATTTTCCAGGAGCTTTCATCAAGTAGTTATAAGTAGAAAAAAATATTT
AAGAAAAGTTAAATGAGTGTAGAAGATTATTCTATGTAGCGTGCACTAGAGCTATGGAAT
AGCTAAAGTTTTGTTTCTTATAATATAAAGAAAAATATGTAAATTTTAGTTAGATAATAT
TTTCATACTATAATAAAATTTTTATTGTTAAGATATGTAGGTTTTTCAGTGAAATTAATA
AATAATATTACTAATCAGATCAAGATTTAAAAAAAGAAGATTTTGCTTAAATCCAATCAA
AATAAAAAAACTAAGTTTAACAAAGAAATTTATAAAATCCTTCCTAAAAAAAATCAACAA
TTGAAGCATTAGATATCAAAAATAAAATAGCTGATATCATACAAAATTTTGACATTAATG
ACTATGAAGTACTGAACAGTTTTCTATAAAAAATAAAACTTCTTAAATATTAAAGAGGGG
AACATGTCACTTTCGACAATGAATAAATAAAATAAAACGCTCTTTAATAAGATTTGATTT
GCTATCTTGAAATGTAAAATTTTATAAATTAATTTTCAGTAAAGATTATTTAATTATTTC
AAAATAAAATTTTAGCTAACTTTTTATATGTAATCGAATGAATATTTTTTATACTAAAAT
CCAGTGATAAGAAAATTATTTTTTAATTCATTTTTCATAAAGCACTTAGCAATTTTAAAA
AATATTCATCGCTATTTATTATCGAATTAATATTTAGAAATAAACATAATTTAATTAAAG
ATTATGTGTATATATAAAACTTATTTTCTGATATATTTTGATGAAAAATAGTATCTCATC
AAAATATTTATAAATTTTGCGTATTATTTCATCTTTTTATATTTTTCTAAAAAGGAGAGC
TTATATTTAAATTAATTTTTTATTTAGATTACTTTATAGAAGTGTTGTTGAAAAATTCTT
GTAAAGCTAGACAATTTAAAATGAAGATGCAGAGAAAATAATACTACGTACAATAAGTTG
GAGTGGATATTAAAAGAGTTTTTATAATAGATACAAAGATTTCTTCAACTAATTAGATTT
TCAAAAATTAGACAGCCTTGAGTCATTTATAGACAATTTCAAAGACTTTAACAAAATCGA
AAAGAAATTAAATAGATTTGAAAATGAGAATTTATCGGATATGTACTCATCAATTTAAAA
ATTTTTAAAACAGTATAAGCTAAATTATAAGTAATATGATTTATTCTAATCAAATAAAAA
TAAAATTTCTTTAATATTTAAAATAGAGATATTCATCATGCAACTGAAACTTATTTTTCA
GATGATTTTGATAGGTAGAAATATTTTGACAGTTATTAACAATTTTCAAATAAAGAATTG
AAAACCTAAAATATTCTCAAAGACATTTATAATGTCAGTAAATTTAGTTTAATTTCCTAA
GGAATAAAGAGATCTTTATACAGAGATGATAGTAGTTTATTTCATAATGAGGATTTAACA
TTAAATATAGATAGATTTTTAAATGTCCTAGAATAATAATATGATTAGAATAGGTTTGAA
ATAAAAAAGAAAATAAATTATGCTAATTTTTATGGGGTTATAGATTTAATAGCATTTGAT
AAAGTAAATTATTTATTTATTAATTAAGTTAGAAGTAAGCGATTGAATAAACATTTTTCT
AATAATTTAAATTTTAAGTAATAGGATAAAGGTGATATATTTTAATTTATCTATTATTAA
GGAGAGTCTGAATTAAGTATTTCTAAACAATAAATTATTTAAGTAAATATTTTCAATTAG
CTTCAGAATTTATAATCAAGCAAATTTACTTATATTAAAAAGTCTCTAGCTTATGCATGT
ATATTAAAAAAAATGAATTACAGGATACAAAATATTGTTTTCTATAATGTACTTCAAGAT
AATTGGATCATTTATTCGATAGAGTAATGGAATTAAGAAGAAGAATTCTTAAGATTTTTG
TAAAAGAAAAAAGAAGATTACTAAAAAGAGTAAGAAGAGAGTGAGGAGACTGATAATAAT
TTAGAGAAAGAGAAGTAATAGTAAGTAAAAATCTAAGAGAAATCTTTGTAAAACTTATAA
GTTCCTATTGAAGAATAAGAAAAAGAGAATAATAGTAAGAATATTAATAATTATAGTCTA
CAAGAAAGTTAATAGGAAAAGAAAAATTAACTTATTTATCAAATTAATTGTCAATATTCT
CAAAATTCAATTTAAAATTAAAGTTAAAATTCTGATTAGACTGTATAAGAAAACAATCTT
TAACATATGTACAAACAAAATGATTAATAAGGCAATATTGACATAGAAAATTAATTTAAT
TTTGGTAATTAAAGTAAGTAAAATGATAATTTAATACAAGTAGCTTTTGATAACTAAAAA
ATTAACCAAAATGAACCATTAGAAAATAAAAATAATTTATTTGGCAATTTTCAATAAATT
AGAGATGACACCAAGAAAATTGAAGAGCCTCGTTAATAATTAATTAATTTAAAAAATCAT
GTAGGAGAGAACTCTTAAGTTTTAGTAAATAGCAATTAGAAAGGACTAAAAAAATCTAAA
GTTGAAAACTAGAAAATTAATTTGAACTAAAAAAGGAAGAAAGAGAAGGATTAAGTTGAT
TATGAATAGTAGAAAATCAATTTTAAAAAACAAAAAGTAGAATAAGGAGAGAAATCTATT
TTCAATATCTAGATAATATTTTTAATAATTTACATATTATTTTAAATCATTAGAACTACA
TTAAAAAACAAGGTATTGTTAACAAACATATTTTTTTATTAAATTTTTTCTAATATAAAT
TAAAGGAAATAAACTCATGA