Identifiers and Description

Gene Model Identifier

TTHERM_00128640

Standard Name

UDH5 (UvrD/REP-family DNA helicase 5)

Aliases

PreTt09428 | 9.m00449 | 3699.m00157

Description

UvrD/REP-family DNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00128640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.15.997537942519205e-151UvrD/REP helicase (1047 aa)
SGDYJL092W0.000000019990673443141236SRS2 DNA helicase and DNA-depe
ndent ATPase involved in DNA r
epair, needed for proper timin
g of commitment to meiotic rec
ombination and transition from
Meiosis I to II; blocks trinu
cleotide repeat expansion; aff
ects genome stability
OxytrichaContig14871.0.0.g770.00000039992052383199455UvrD-like helicase C-terminal
domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00128640(coding)
ATGGAATAAAAAGTTTCAGATAACAATAGCTTTTAATAAAACATAGCATTAACTGATGAA
TAATAAAAAATAATTTATTCGAATATCGATGAAGATCAAAGAATTTTAGCATGCGCAGGT
TCAGGTAAAACAACTACACTAATTTATCGAATCGAGTATTTGATTAAATAAGGAATACCT
GCAAGCTAAATATTACTGAGTACTTTTAATGTTGAAGCTGCTAATAACTTAAAAATAAAA
GCAAAACAAGTGTTACATTAAGATGAAGTAGAAGAAAAAAATATAATGAACATAGACAAA
TTTACTGCTGATATTTATAAGAATTATATAAAAGATAATGATAAAAACTTTAAATTAGAT
GTAAAAGAATTTGGATATAAAGTTAAAAATTACTTAAGTACAATAGAAGGAGAATAAAAG
GTTTTAAAGTAATATAAATACTTTTTTTTTGATGAGTTTTAAGATGTAAATCAAATCTAG
TATGACATCCTAATTCTTTTCAAAAAAGCAGGATGCAAAATTATTGTTATAGGAGATGAG
GCTTAAAATATTTACAGCTTTAGAGATACTAAATTAGAATTTATTCAAAGCAAAATAAAT
TAAGATATACTAAAAATCTCATAATAGGAAATAAAAACATATCACCTTAGCATAAATTTT
AGATGTTCAAGCAAAATCACAAAATTCTGCAATTAAATTTTTGCAAACACGTAGCATTTT
GCAAAACCTATGTAAAGCTTAAAAGAAGCGGACTAAGTGAAATTTTATCCTAAAATTAGA
CTTTATAAAAATTCAGATGAGTTAGTAAATGATATAATTATACAACTTCAAAATTTAATA
AATATCTATTAGTGGAGTGATTTGGCAATACTTAGTCCTACAAGAAAACCATTAATACAT
TTTTAGGAAATTTTAGAAAAGCATAATTCTACTTTATAACAGATAATTCCCTATTCCTTA
AGATTCAGAGATATGAATAATGTTTTCACTTGTGATAATTCTGATGCTACTGAGGAGTAA
AAGAACTTGACTTTGAGCACGATTCATGCTTCTAAGGGTTTAGAATGGAAAGTAGTATTT
ATAATCGGAATTAATGATTCAAATTTTCCAGGAGTTTTCATCAACTATTTATAAGAAGAA
AACGAAATTTAAGAAAAGTTAAGCGAGTGCAGAAGATTATTCTACGTAGCTTGTACTAGA
GCTAAGGAATAATTAAGCTTTTCTTTCATAAAATAAAAAGGAAAATATATATGTAGATTT
TTCAGTGAAATTAATGAAGAATAATATGAATGCTAAGATACAAATTTTAAAAGAGAACAT
ATAGCTTAAATCCAATCAAAAAAATCAAATTTTAAACCATTAAATATCAAGAACAACATA
GCTGATATCATACAAAATTTTGACTTTAATGACTATGAAGTAGTGAACAGTTTTCTATAA
AAAATATAACTTGTTAATAAAGAAACAGGAAAAGAGGCCACTTACAACAGTTAAAAAATA
AGATAAAACGCTCTTTAATAAGATTTGATTTGTTATCTTGACATATTACTTTATAGATGT
GTTACCGAAAAATACTTATAAAGCTAGAAAATTTTAAATGAAGATGCTGAGAAAATACTA
TGTACAATAAATTGGAAAGGAAAATCAAAGGTTGTTTATAATAAATTTATAGAATTCTTC
AACAAAAAAAGTTTAATAGATTTAGAAATATTGAACAGCCAGGAGTAATTTATAAACTGT
TTAAACAATCATTACAGTAACAAGTAGCAATTTGATCAAAATGAAATTAAAATTTTACAA
GAAATGCGTACATAAATTAAATCATTTTTAGAAAAAAATAAACTAAAATATGAAGATATT
TGCCATGCAACTGAGAGTCACTCGTTGGATTATTTTCCTGAAGATTTTATGGATAAGTAG
AAATATGTTGACAGTTATTTAAAATTTTCAGATAAAACATAGAAAACAGAAAATATTATC
AAAGATGTTTATAATGTGAGTAAATGCCATTTAATTTCCTAAGGAATAAGGAGATCATTG
TACAGAGATGATATTGAATTACTTTAACCTTGGAATTTAAAATTAAATATCAATAGATTT
TTAAAAAGTCTCAATTTAAAATATGATAAGAATAGGTTTGAAATAAAAAAGAAAGTAGAA
TATGATAGTTTAAATGGAGTTATAGATTTAATAGCATTTGATAAAGATAAAGGTGATATA
ATTTAATTTATCTATCATTAAGGAAAGTCTAAATTAAGCATTTCTAAAGAATAAATTATT
CAATCTCTAGTTTATGCATACATATTAAAAAAGAAAAGTTACAGTATAAAAAATATTGTT
TTCTATAATGTACTTAATGAAGATTTGATCACTTATTCGATAGATTAATGGAATTAAGAA
GAAGAATTCTTAAGATTTTTGTAAAAGAAAAAAGAAGATTACTAAAAAGAGTAAGAAGAG
ACTGATGATAATTTAGAGGAAGAAGAAGATTAATAGGAATTAGAAATCTAGGAGAATACT
TTGTAAAACTTATACACTTCTATTGAAGAAGAACAAGAAGATGAAAAAGAAGAAAAAGAG
AATAATAGTAAGAAAATTAATAATTATAACCTATAAGAAAGTTAATAGGTATAGAAAAAT
TAACTTCCTTATCAATTTAATAATCTATATTCTAGAAGTTCAACTTAAAATTTAAGTTAA
AATTCTGTTTAGACAGTATAAGAAAATAATCTTTAATGTAAGTACAATTAAAATGATTAA
GAAGATAATGTTGAGATCGAAAATTAATTAATTTATGGTAATTAAAGTGATTAAAATGAG
AATTTAATACAAAAAGCTTTAGATAACTAAAAAATTAACTAAAATGAGCCATTAGAAAAT
CAAAATAATTTAGTTAGCAATATTCAATAAAATAGAGATAACTCCAAGAAAATTGAAGAG
CCTTGTTAATTATTATTTAATTTAAAGAATCATGAAGATGAGAACTCTTAAATTGAAAAC
AAAATGAGTAATTTAAACTCAAAAAGGAAGAGAGAGAAGAATTAAGTTGAATATGAATAG
TAGAAAATCAATTTAAAAAAACAAAAAGTAGAATTAAAAGAGAAAGCTATCAATGTCTAG
ATTATATTTTTTATAATTTATATATTAATTTAAGTCTTTTAAACTTCATTACAATACAAG
GTAATTATTTTTAACAAATAAATTTTTAATTTAATTTTGTTTAATGTAAATTAAAGGCAA
TAAACTCATGAAGAATCAAAAAATGTGGCTAAGAATACAAATCAAAAGCCAAAATTATTT
TTTTCTTTAATAAAATTAGTTAATATATTTCTGTGTTAAATTAATGTTTTAATTCTTATT
TTCTATGATTTGTCAGCATATTGTAAAATTAATATTTAAATAAGCATTTTAAAGTTTAAG
AGTTGTGCATCACCTTCGATTGAAAATTTTTTATATTTAAATTTAATTTCCATATATTTT
TTATAAAATAGACTTAATTACATTGTTACATTGTAAAAAATTTAATATTTTTCTTTCAAA
GTAAAGATAATTTTAATTTTAATTGTCAATTTTAAAAAGCTTACTGTATATTTAAGATTT
AAAAATATGAAATTATTTGCTTAACTAAATATCATTTTTTTATGGAAAAAAAAAGATTCA
TGCTTGTCTTAATCATTTATACCATATCCTCACATTTTATTTAATACATTTTTCAATAGA
ATTTTATTCAAAAAATGTATTCTAAATTTATAAAATGTAATAGAAATTGAATGA


>TTHERM_00128640(protein)
MEQKVSDNNSFQQNIALTDEQQKIIYSNIDEDQRILACAGSGKTTTLIYRIEYLIKQGIP
ASQILLSTFNVEAANNLKIKAKQVLHQDEVEEKNIMNIDKFTADIYKNYIKDNDKNFKLD
VKEFGYKVKNYLSTIEGEQKVLKQYKYFFFDEFQDVNQIQYDILILFKKAGCKIIVIGDE
AQNIYSFRDTKLEFIQSKINQDILKISQQEIKTYHLSINFRCSSKITKFCNQIFANTQHF
AKPMQSLKEADQVKFYPKIRLYKNSDELVNDIIIQLQNLINIYQWSDLAILSPTRKPLIH
FQEILEKHNSTLQQIIPYSLRFRDMNNVFTCDNSDATEEQKNLTLSTIHASKGLEWKVVF
IIGINDSNFPGVFINYLQEENEIQEKLSECRRLFYVACTRAKEQLSFSFIKQKGKYICRF
FSEINEEQYECQDTNFKREHIAQIQSKKSNFKPLNIKNNIADIIQNFDFNDYEVVNSFLQ
KIQLVNKETGKEATYNSQKIRQNALQQDLICYLDILLYRCVTEKYLQSQKILNEDAEKIL
CTINWKGKSKVVYNKFIEFFNKKSLIDLEILNSQEQFINCLNNHYSNKQQFDQNEIKILQ
EMRTQIKSFLEKNKLKYEDICHATESHSLDYFPEDFMDKQKYVDSYLKFSDKTQKTENII
KDVYNVSKCHLISQGIRRSLYRDDIELLQPWNLKLNINRFLKSLNLKYDKNRFEIKKKVE
YDSLNGVIDLIAFDKDKGDIIQFIYHQGKSKLSISKEQIIQSLVYAYILKKKSYSIKNIV
FYNVLNEDLITYSIDQWNQEEEFLRFLQKKKEDYQKEQEETDDNLEEEEDQQELEIQENT
LQNLYTSIEEEQEDEKEEKENNSKKINNYNLQESQQVQKNQLPYQFNNLYSRSSTQNLSQ
NSVQTVQENNLQCKYNQNDQEDNVEIENQLIYGNQSDQNENLIQKALDNQKINQNEPLEN
QNNLVSNIQQNRDNSKKIEEPCQLLFNLKNHEDENSQIENKMSNLNSKRKREKNQVEYEQ
QKINLKKQKVELKEKAINVQIIFFIIYILIQVFQTSLQYKVIIFNKQIFNLILFNVNQRQ
QTHEESKNVAKNTNQKPKLFFSLIKLVNIFLCQINVLILIFYDLSAYCKINIQISILKFK
SCASPSIENFLYLNLISIYFLQNRLNYIVTLQKIQYFSFKVKIILILIVNFKKLTVYLRF
KNMKLFAQLNIIFLWKKKDSCLSQSFIPYPHILFNTFFNRILFKKCILNLQNVIEIE


>TTHERM_00128640(gene)
ATGGAATAAAAAGTTTCAGATAACAATAGCTTTTAATAAAACATAGCATTAACTGATGAA
TAATAAAAAATAATTTATTCGAATATCGATGAAGATCAAAGAATTTTAGCATGCGCAGGT
TCAGGTAAAACAACTACACTAATTTATCGAATCGAGTATTTGATTAAATAAGGAATACCT
GCAAGCTAAATATTACTGAGTACTTTTAATGTTGAAGCTGCTAATAACTTAAAAATAAAA
GCAAAACAAGTGTTACATTAAGATGAAGTAGAAGAAAAAAATATAATGAACATAGACAAA
TTTACTGCTGATATTTATAAGAATTATATAAAAGATAATGATAAAAACTTTAAATTAGAT
GTAAAAGAATTTGGATATAAAGTTAAAAATTACTTAAGTACAATAGAAGGAGAATAAAAG
GTTTTAAAGTAATATAAATACTTTTTTTTTGATGAGTTTTAAGATGTAAATCAAATCTAG
TATGACATCCTAATTCTTTTCAAAAAAGCAGGATGCAAAATTATTGTTATAGGTATTGTT
TGTTTAACTTCTACTATTTATTTAATTAAATCAACCTAATTTTTAAAATTATTTTTTTAG
GATTTTTTATAAATATCTTATTTAAACTAGGAGATGAGGCTTAAAATATTTACAGCTTTA
GAGATACTAAATTAGAATTTATTCAAAGCAAAATAAATTAAGATATACTAAAAATCTCAT
AATAGGAAATAAAAACATATCACCTTAGCATAAATTTTAGATGTTCAAGCAAAATCACAA
AATTCTGCAATTAAATTTTTGCAAACACGTAGCATTTTGCAAAACCTATGTAAAGCTTAA
AAGAAGGTATAGATCACAAAACTAAATAAATAAATAAAAATCATTTTATTATTTTAATTT
AAATTTTTTTTATATTTTAAATATTAAAGCGAATTAAATAAACAAATTCTTTACATAATT
AAATGATTAATAATCTTTTAATACTTTAGCTACATGTAAACATGTTCAAATTTTTTAAAA
AAATAGCGGACTAAGTGAAATTTTATCCTAAAATTAGACTTTATAAAAATTCAGATGAGT
TAGTAAATGATATAATTATACAACTTCAAAATTTAATAAATATCTATTAGTGGAGTGATT
TGGCAATACTTAGTCCTACAAGAAAACCATTAATACATTTTTAGGAAATTTTAGAAAAGC
ATAATTCTACTTTATAACAGATAATTCCCTATTCCTTAAGATTCAGAGATATGAATAATG
TTTTCACTTGTGATAATTCTGATGCTACTGAGGAGTAAAAGAACTTGACTTTGAGCACGA
TTCATGCTTCTAAGGGTTTAGAATGGAAAGTAGTATTTATAATCGGAATTAATGATTCAA
ATTTTCCAGGAGTTTTCATCAACTATTTATAAGAAGAAAACGAAATTTAAGAAAAGTTAA
GCGAGTGCAGAAGATTATTCTACGTAGCTTGTACTAGAGCTAAGGAATAATTAAGCTTTT
CTTTCATAAAATAAAAAGGAAAATATGTAAACTTTAGATAATATTTACATGCAATAATAA
TATTTTAATTATTAAGATATGTAGATTTTTCAGTGAAATTAATGAAGAATAATATGAATG
CTAAGATACAAATTTTAAAAGAGAACATATAGCTTAAATCCAATCAAAAAGTAAAATCTA
AATTAAAAAAATAAATTTAAATTATTTTTCTAAAATAGAATCAAATTTTAAACCATTAAA
TATCAAGAACAACATAGCTGATATCATACAAAATTTTGACTTTAATGACTATGAAGTAGT
GAACAGTTTTCTATAAAAAATATAACTTGTTAATAAAGAAACAGGAAAAGAGGCCACTTA
CAACAGTTAAAAAATAAGATAAAACGCTCTTTAATAAGATTTGATTTGTTATCTTGACAT
GTAAAATTTAATAAATTAATTTTCAGTAAAGATAAATTAATAATATCAAAATAAAATACT
AACTTACTTTTTATATAAACTTAAATTCCGCGCTTTTTCTACAAGACCAGCCATTTAACA
CTTAATAAATAAAAATATAAAAATATTTAATTAATCTTATTTGGTTATTCAACCTTTTTA
TATTTATCATAATAAAAATGAGAACTTACATTTACATTTATTTTTTATTTAGATTACTTT
ATAGATGTGTTACCGAAAAATACTTATAAAGCTAGAAAATTTTAAATGAAGATGCTGAGA
AAATACTATGTACAATAAATTGGAAAGGAAAATCAAAGGTTGTTTATAATAAATTTATAG
AATTCTTCAACAAAAAAAGTTTAATAGATTTAGAAATATTGAACAGCCAGGAGTAATTTA
TAAACTGTTTAAACAATCATTACAGTAACAAGTAGCAATTTGATCAAAATGAAATTAAAA
TTTTACAAGAAATGCGTACATAAATTAAATCATTTTTAGAAAAAAATAAACTAAAATATG
AGTAATATGATTTATTTTAATCAAATATAAATAAAGTATCTTTAATATTTAAAATAGAGA
TATTTGCCATGCAACTGAGAGTCACTCGTTGGATTATTTTCCTGAAGATTTTATGGATAA
GTAGAAATATGTTGACAGTTATTTAAAATTTTCAGATAAAACATAGAAAACAGAAAATAT
TATCAAAGATGTTTATAATGTGAGTAAATGCCATTTAATTTCCTAAGGAATAAGGAGATC
ATTGTACAGAGATGATATTGAATTACTTTAACCTTGGAATTTAAAATTAAATATCAATAG
ATTTTTAAAAAGTCTCAATTTAAAATATGATAAGAATAGGTTTGAAATAAAAAAGAAAGT
AGAATATGATAGTTTAAATGGAGTTATAGATTTAATAGCATTTGATAAAGTAAATTATTT
ATTTATTTATTAATATAGTGAGTGATTGAATGAATAATTTTTTTTTTATAATATAAATTT
TAAAATAAATTATAATAGGATAAAGGTGATATAATTTAATTTATCTATCATTAAGGAAAG
TCTAAATTAAGCATTTCTAAAGAATAAATTATTCAAGTAAACATTTTCAATTAGCTTCAT
AATTTATATTCAAGCAAATTTATTTATATCAAAAAGTCTCTAGTTTATGCATACATATTA
AAAAAGAAAAGTTACAGTATAAAAAATATTGTTTTCTATAATGTACTTAATGAAGATTTG
ATCACTTATTCGATAGATTAATGGAATTAAGAAGAAGAATTCTTAAGATTTTTGTAAAAG
AAAAAAGAAGATTACTAAAAAGAGTAAGAAGAGACTGATGATAATTTAGAGGAAGAAGAA
GATTAATAGGAATTAGAAATCTAGGAGAATACTTTGTAAAACTTATACACTTCTATTGAA
GAAGAACAAGAAGATGAAAAAGAAGAAAAAGAGAATAATAGTAAGAAAATTAATAATTAT
AACCTATAAGAAAGTTAATAGGTATAGAAAAATTAACTTCCTTATCAATTTAATAATCTA
TATTCTAGAAGTTCAACTTAAAATTTAAGTTAAAATTCTGTTTAGACAGTATAAGAAAAT
AATCTTTAATGTAAGTACAATTAAAATGATTAAGAAGATAATGTTGAGATCGAAAATTAA
TTAATTTATGGTAATTAAAGTGATTAAAATGAGAATTTAATACAAAAAGCTTTAGATAAC
TAAAAAATTAACTAAAATGAGCCATTAGAAAATCAAAATAATTTAGTTAGCAATATTCAA
TAAAATAGAGATAACTCCAAGAAAATTGAAGAGCCTTGTTAATTATTATTTAATTTAAAG
AATCATGAAGATGAGAACTCTTAAATTGAAAACAAAATGAGTAATTTAAACTCAAAAAGG
AAGAGAGAGAAGAATTAAGTTGAATATGAATAGTAGAAAATCAATTTAAAAAAACAAAAA
GTAGAATTAAAAGAGAAAGCTATCAATGTCTAGATTATATTTTTTATAATTTATATATTA
ATTTAAGTCTTTTAAACTTCATTACAATACAAGGTAATTATTTTTAACAAATAAATTTTT
AATTTAATTTTGTTTAATGTAAATTAAAGGCAATAAACTCATGAAGAATCAAAAAATGTG
GCTAAGAATACAAATCAAAAGCCAAAATTATTTTTTTCTTTAATAAAATTAGTTAATATA
TTTCTGTGTTAAATTAATGTTTTAATTCTTATTTTCTATGATTTGTCAGCATATTGTAAA
ATTAATATTTAAATAAGCATTTTAAAGTTTAAGAGTTGTGCATCACCTTCGATTGAAAAT
TTTTTATATTTAAATTTAATTTCCATATATTTTTTATAAAATAGACTTAATTACATTGTT
ACATTGTAAAAAATTTAATATTTTTCTTTCAAAGTAAAGATAATTTTAATTTTAATTGTC
AATTTTAAAAAGCTTACTGTATATTTAAGATTTAAAAATATGAAATTATTTGCTTAACTA
AATATCATTTTTTTATGGAAAAAAAAAGATTCATGCTTGTCTTAATCATTTATACCATAT
CCTCACATTTTATTTAATACATTTTTCAATAGAATTTTATTCAAAAAATGTATTCTAAAT
TTATAAAATGTAATAGAAATTGAATGA