Identifiers and Description

Gene Model Identifier

TTHERM_00128620

Standard Name

UDH4 (UvrD/REP-family DNA helicase 4)

Aliases

PreTt09426 | 9.m00447 | 3699.m00155

Description

UDH4 UvrD/REP helicase family protein; UvrD/REP helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00128620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.19.997093137033517e-262UvrD/REP helicase (1047 aa)
SGDYJL092W0.00000005999527666938375SRS2 DNA helicase and DNA-depe
ndent ATPase involved in DNA r
epair, needed for proper timin
g of commitment to meiotic rec
ombination and transition from
Meiosis I to II; blocks trinu
cleotide repeat expansion; aff
ects genome stability

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00128620(coding)
ATGGACAACTAAAATAAATATAGAGTAATTAATTATTAGGATTATAATGGATCGGAGTGT
GAGATCAGGCCTAGCTAAGAATAATTAAAAGTAATTTTATCAGATTTAAATGAAGATTAA
AAAATTATAGCATGTGCAGGTTCTGGTAAAACAACAACTTTAGTGATAAGATTAAAATAT
CTGATAGACTAAGGAGTTTAGCCAGAATAAATTTTAGTCACTACTTATAATGTTGATGCT
GGAAAAAACTTAAAAAAAAGGGCAAAAGAAATAATAGGATGCCAGTCTTGCAGGATAGAA
ATAGGAAATATTGATAAAGTGGCTTTTAAAATATACTAAAAATTCATTTTGAGTGCTTAA
AAGTAATAATCTGATTTAAAATCTAGTGTTAAGGAGTTTTGTAATAAGCTTTATCAGTTC
TTATAAACGCCTGAAGGGGAATAATAAGTATTGTCAAAGTATAAGTACTTTTTCTTTGAT
GAGTTTTAGGATGTAAATCAATTGTAATATGATATTCTAATCCTTTTTAAAAAGAAAGGT
AGCAACATTACTGTTATTGGTGATGATGCTTAAAACATTTATGGATTCAGAGACTCAAAA
TTGGAACTGATTTAGAAATAAATTGATTAGGATGTATTAAAAATAACAAATAAAAAGATA
CATGAATACTAACTATCTTTAAACTATAGGTGCTCTAAGCCTATAACAGAGTTTTCAAAC
TAAATTATAGCTAAATCCAAATATTTGATTTAAAAAGAGATGAAATACAACACATAAAAG
AATTACTAAAAAAGCTAGTAGCCATAGATTAAGCTATATAAAAATTGGGAACACTAAGTT
AACAGCATAATTGACTAAATTAAATATCTATAAGAAACATACTCACTTAATGAAATAGCT
ATTCTAAGTCCAACAAATCTTCCATTAAGATTCTTTGAAGAAAAGTTAGAAAAGAATAAC
AAGGAGTTAATTAATGGATAAATCCCTTTTATTTACAGATCTTAGAGCATTAAAGAATTT
TACTCGATCAATGATGATGATCCCAATGATACAGAACCTAAGCTCACTTTAAGTACTTTG
CACCAAGCAAAAGGATTAGAATGGAAAATAGTATTTTTTATAGGGATAAATGATTAGCAT
TTTCCTGGAGAATTCATGAATTAGAGAACATTTAAACTATAAAAATTAGAAGAATGCAGG
AGATTATTCTATGTTGGGTGTACAAGAGCTATTAATCAGCTTAATTTTTCTATTTTATAA
AGGAAACCATAAGAAAAATGTCCTATAGTTTGTAGATTTTTCAGTGAGATTGATTAATAA
TATTTTAAAGTAGATGAAAATATAAAAAAAGAAGATTTTGCACCTATATAAGGCCAAGAA
AATTGCAGGCATAAAGGTTTGGAAAATTAGACTTAAATAACTAAAATTATTGAAGAATTC
AATTATCATGATTTAGAGAAAATAGATAAATATTTAAAAGATATTAAATTTTTTCTCAAG
GAAGATATTCATAAAAAGCCAAGTTTTGATATAAAGTAAATTGCAAAAAATAGACTTTCG
GTGGATTTAGGGATTTATATTGATATATTATTTTAAAGAATAATTGCTGAAAAATATAAC
TCTGTCTAAGGCTATACTTATAGTGATGCAGAGAAAGTCCTTTTTTCTATAAATTGGGCT
AATTAAAGGGCAGAGATTGTTTTTAAATACAAGCAATTTTTTGAAAATAAGAATTTACAA
TTTGATTAGATAGAGGATTCAGATGAATTCATAGATGTAATTAATATGTTTTATATCGAA
AAGAGTAAGCAAACCTTTAAACTTTAAGATAGAGAAATAAAAGTTTTAAAAGATATCTAT
GAGGAATTAAAAAAATTTATGGCAAGAAATAATTTAAATTACAGCAACGTCAGCCATTTG
TTAATTGAAGGAAAGAATGATCGAGTGCTTTAGTTTTTTCCTGAAGATTTTGATGACAAA
CACATTTATATAGAAAGCTATAAAAAATATTGTAATCCAAATTACTAAACTATGGATATT
TTATATGATATTTACAATGTCAGCAAATGTGGCTAATTAGTAAATTTAATAAGAAGAAGT
CTTTATAGAAACGATTTCTAGCTATTTAATCCAATAGATTTAAAATTAATTATTGATAAG
TTTTTGGATTTTCTTAAAAAGTAAAATTTTAAAAAGATACAAGTTAAAAAAAGGGTAAAA
GATGATAACTTAATTGGTGAAATAGATTTTATTGCAGATGATACTATTTTTGAAATTAAA
TCCTCTTCATCCTATGAAGTACAAAAAGAATACATTATACAGTGTTTAGCATATGCATCA
TTGATGAGAAAATAGGGTGAAAAAATTAATTCAATTGCATTTTATAATCCCCTGCAAGGA
TATACTTCATTTTATGATATCTCTAATTGGAATTAAGAAAATGAATTTTGTGATTTCCTT
TTTTAGACTTCTTTAAATAAAATTATAGAAAAATAATAATAAAGTTAAAGCTTTACCAAT
GATCCACCAATTGATTAAAATGAATACATATTAATTGAAGAGGATTAGGAAGACTCTTAA
GATTGTATAGAAATATAAAGCGAAGAATTTAGAGATAATTATAATACATAGCATTATATT
GAGCAGCTCCAAGATTATGTGAAGAAAGATAACTCATGCAATGGCATATAATAATTAATA
GAAGTAAGCGAGCACAAAATTAATGAAAAACTAGGGACAGAGTACAAAAAATTGCACTTT
GTAGAAAAAATATCAAATGAATTAGAATTTTTGGAGTCAGGAAGTTAATTTATAAGTTCA
AATCAGAAAAATATAAATTAGTTACTGGAAAATAAATGTGAATTAGATTAAAATCAAAGT
GATTATCAAACTGAATAAAAGTCTTAAAAAATTCATTAAAAAAATGTAAGTAATTTAGAT
TTTAGTGATACTGAATCAAATTATTCAAACAAGCAAAATTAAAATATTTCGCTATCACCT
AGTAGTTTAAATATAACTCCAATTAAATTAAGCTAAGCGATTTAGCCTGAATATGTTGTA
ATCGAAGATGATTAGGAATTAGACTTTTTAAATAATAGCAAAAATTTTGATAAAAGAACA
TTAAACGAAATGGAAAATGAAAGATAAATTCAGCAATAGTTGTTTGAATAAAAATATTAA
GAAAAGGTTAATTAAAATGTTAATTTATTTCTTGAATAGTTTTCTAACAAAATTAATTAT
CAAAACTAAATAATAAATCAATAAAATTAAAACATCAATGAGTTATAAAACTGTTCAAAC
TTAAATCCAATAAAACTTAATAATGAAACTGGTTTAAATTAAAAAATAGGTTAAAATAGT
CAAGAGAGAGATATTGGCAATACAATTCCATTAATAAATGAAAAAATTCATAATAGAGAA
TAAAATTAATGTTTTTTCAACTGTAATGATTTAATATCTATTGAATCATCTCATGAAAAA
GAAGAAATTTAAAATAACGATGATATTTAATTTGAATAAGATTCCTTATCATCTGAGCTA
GATATAATGTAGACCTCACAGTTATAAATTAATCCTATTAACTTATCTGAAATTGATTTT
ATTTAATAATATGACTCTGAATCATAATTGAAAACAAGCAATATTGGCTGTAAAAGACGA
GATATTGAAGTTAAAAGTGAAAGTAAAAAAGGATATTCACAAGATGATGTTGAAAACAAA
GATCATTTAAAACAAAATTAATAAATCTATAAAGAAAATTTAAGTGAAAAAAATTAAATA
TGTGACTAAATTTATGATCAAATTACATTTAGTTAATTATTCAATCACTCAGACTCACAT
AAAAATAATTAAGAATATGAAAACAATAAAGAATAAGAGCAAGATATGAAAGATTAAAAA
GTCAGTATTTATTTTGAAGATAATCAAAAATAACCTTATGAACACTTTATAAATTGCAAT
TTGTCTATCCAGTGCTCTATTAATGACTAGTATATAAATAATCAATAATAAAAATATGAA
GATTTACCATAAATGAAACAAGATAACTCTGAGTAAGAATCATAGTCATAATAGTAATTT
AATGACTAAAATGTTGAAAAATATATTATTGAAAGCTAATTATAAAATAAATAGAATACT
GTAAATTTAAACAAATAATAATCATAATCTGGTCTAAAAATTGAAAGTTAGTTTAATGTT
TATGAATCAGAGATAAGTAAACAATTTTAGGTGGAATATAAAGAGTAATAATAAGATAAC
TATGGCTAGAGTGGTTAAAATAACTTATATTTGAGTAATTAGTCTAATAAAACACAATAA
TAAATAGATAAAAGCGAATTTCAAACTAACTAGGAAAATTCTAAAAATAAATAAAATTTA
TAATAATTTAATCAAAATGGAAGCAAACTAAAATTGTAGAAAAGCAACTCTGAAAATATT
GGAAATGGTATGACGAATTTAATAGAAAACAATTAAATGTAAAAAAATTTCAATAAGATA
ATATCTAATTTAGACAATTAAAATTAATTTTAAAATACAAAATAACTCACACTTTAAAAT
ATGGAATCATTTTAAATTTAAAACTATTAAAATGGATTTGAAAATCTTTAAATAGCTAAT
AATTCAAATTATCATTAAAAAAATGACATTTAATTTTTGAATTAACAATATAATAAGAAA
AATTATCATTTAGCTTCTCATGAAAATGATGAAATTAAAAACTTATAAAGTCATCCATTA
CAAGGTGAAATTATAGAATATAATAATGAGAAAAAAGAAATTGTAACATAAAAATGTTTA
GAAGAAATACACTAATAAACTAATGTTGAGAATATTAATTTCCCTTAAAATTATTAAATT
TAAAGATTTTAGAATATAAAAAATATATAAAACAGTAATTTAAAACAATTAAACAGCAAA
AGAAAAGCGAATGAAACCATTCACTAATTACAAAAAGAGTTTTAATAAGATATATAAAAG
AAAATAAAAATTGAACCAAATTATGATATTAAACATACTCAAATAACATTTTGCAAAGAG
CTTCTAATATTATTATCGCTCATTTGGTTTACATTTATGCTTTTCAAAAATAAATAATTT
TAATGA


>TTHERM_00128620(protein)
MDNQNKYRVINYQDYNGSECEIRPSQEQLKVILSDLNEDQKIIACAGSGKTTTLVIRLKY
LIDQGVQPEQILVTTYNVDAGKNLKKRAKEIIGCQSCRIEIGNIDKVAFKIYQKFILSAQ
KQQSDLKSSVKEFCNKLYQFLQTPEGEQQVLSKYKYFFFDEFQDVNQLQYDILILFKKKG
SNITVIGDDAQNIYGFRDSKLELIQKQIDQDVLKITNKKIHEYQLSLNYRCSKPITEFSN
QIIAKSKYLIQKEMKYNTQKNYQKSQQPQIKLYKNWEHQVNSIIDQIKYLQETYSLNEIA
ILSPTNLPLRFFEEKLEKNNKELINGQIPFIYRSQSIKEFYSINDDDPNDTEPKLTLSTL
HQAKGLEWKIVFFIGINDQHFPGEFMNQRTFKLQKLEECRRLFYVGCTRAINQLNFSILQ
RKPQEKCPIVCRFFSEIDQQYFKVDENIKKEDFAPIQGQENCRHKGLENQTQITKIIEEF
NYHDLEKIDKYLKDIKFFLKEDIHKKPSFDIKQIAKNRLSVDLGIYIDILFQRIIAEKYN
SVQGYTYSDAEKVLFSINWANQRAEIVFKYKQFFENKNLQFDQIEDSDEFIDVINMFYIE
KSKQTFKLQDREIKVLKDIYEELKKFMARNNLNYSNVSHLLIEGKNDRVLQFFPEDFDDK
HIYIESYKKYCNPNYQTMDILYDIYNVSKCGQLVNLIRRSLYRNDFQLFNPIDLKLIIDK
FLDFLKKQNFKKIQVKKRVKDDNLIGEIDFIADDTIFEIKSSSSYEVQKEYIIQCLAYAS
LMRKQGEKINSIAFYNPLQGYTSFYDISNWNQENEFCDFLFQTSLNKIIEKQQQSQSFTN
DPPIDQNEYILIEEDQEDSQDCIEIQSEEFRDNYNTQHYIEQLQDYVKKDNSCNGIQQLI
EVSEHKINEKLGTEYKKLHFVEKISNELEFLESGSQFISSNQKNINQLLENKCELDQNQS
DYQTEQKSQKIHQKNVSNLDFSDTESNYSNKQNQNISLSPSSLNITPIKLSQAIQPEYVV
IEDDQELDFLNNSKNFDKRTLNEMENERQIQQQLFEQKYQEKVNQNVNLFLEQFSNKINY
QNQIINQQNQNINELQNCSNLNPIKLNNETGLNQKIGQNSQERDIGNTIPLINEKIHNRE
QNQCFFNCNDLISIESSHEKEEIQNNDDIQFEQDSLSSELDIMQTSQLQINPINLSEIDF
IQQYDSESQLKTSNIGCKRRDIEVKSESKKGYSQDDVENKDHLKQNQQIYKENLSEKNQI
CDQIYDQITFSQLFNHSDSHKNNQEYENNKEQEQDMKDQKVSIYFEDNQKQPYEHFINCN
LSIQCSINDQYINNQQQKYEDLPQMKQDNSEQESQSQQQFNDQNVEKYIIESQLQNKQNT
VNLNKQQSQSGLKIESQFNVYESEISKQFQVEYKEQQQDNYGQSGQNNLYLSNQSNKTQQ
QIDKSEFQTNQENSKNKQNLQQFNQNGSKLKLQKSNSENIGNGMTNLIENNQMQKNFNKI
ISNLDNQNQFQNTKQLTLQNMESFQIQNYQNGFENLQIANNSNYHQKNDIQFLNQQYNKK
NYHLASHENDEIKNLQSHPLQGEIIEYNNEKKEIVTQKCLEEIHQQTNVENINFPQNYQI
QRFQNIKNIQNSNLKQLNSKRKANETIHQLQKEFQQDIQKKIKIEPNYDIKHTQITFCKE
LLILLSLIWFTFMLFKNKQFQ


>TTHERM_00128620(gene)
ATGGACAACTAAAATAAATATAGAGTAATTAATTATTAGGATTATAATGGATCGGAGTGT
GAGATCAGGCCTAGCTAAGAATAATTAAAAGTAATTTTATCAGATTTAAATGAAGATTAA
AAAATTATAGCATGTGCAGGTTCTGGTAAAACAACAACTTTAGTGATAAGATTAAAATAT
CTGATAGACTAAGGAGTTTAGCCAGAATAAATTTTAGTCACTACTTATAATGTTGATGCT
GGAAAAAACTTAAAAAAAAGGGCAAAAGAAATAATAGGATGCCAGTCTTGCAGGATAGAA
ATAGGAAATATTGATAAAGTGGCTTTTAAAATATACTAAAAATTCATTTTGAGTGCTTAA
AAGTAATAATCTGATTTAAAATCTAGTGTTAAGGAGTTTTGTAATAAGCTTTATCAGTTC
TTATAAACGCCTGAAGGGGAATAATAAGTATTGTCAAAGTATAAGTACTTTTTCTTTGAT
GAGTTTTAGGATGTAAATCAATTGTAATATGATATTCTAATCCTTTTTAAAAAGAAAGGT
AGCAACATTACTGTTATTGGTAATAATAATTATTTCTTCTACTTTTACAATAATATCTGC
AATTTATCATATTCTGCTACATAAATTATGCTAAAAATGTATTTTTAAAGATGATAGATA
ACTAACTATAACTATTCCTATTAAATCCACAAACATATTTAAATACTTTTCTCTTAAAAT
GATTTTCAATTAAATTAATAGGTGATGATGCTTAAAACATTTATGGATTCAGAGACTCAA
AATTGGAACTGATTTAGAAATAAATTGATTAGGATGTATTAAAAATAACAAATAAAAAGA
TACATGAATACTAACTATCTTTAAACTATAGGTGCTCTAAGCCTATAACAGAGTTTTCAA
ACTAAATTATAGCTAAATCCAAATATTTGATTTAAAAAGAGATGAAATACAACACATAAA
AGAATTGTAATTAATCTAAACACTTTCTTTTTTTCTTTACTAATGTTTTTTTAATTATTA
TTTTATCTCTATAATAAGATACTGATTTGATTGCAACTATTTTCTAAAAACATTATATTA
TTCTTATCATTTAATAGAATATTAATTATTGTCTTATTTTTTTAGAGAGAGATATTTATC
AAATTTATCATCTTTTTTTTATTGAAAGACTAAAAAAGCTAGTAGCCATAGATTAAGCTA
TATAAAAATTGGGAACACTAAGTTAACAGCATAATTGACTAAATTAAATATCTATAAGAA
ACATACTCACTTAATGAAATAGCTATTCTAAGTCCAACAAATCTTCCATTAAGATTCTTT
GAAGAAAAGTTAGAAAAGAATAACAAGGAGTTAATTAATGGATAAATCCCTTTTATTTAC
AGATCTTAGAGCATTAAAGAATTTTACTCGATCAATGATGATGATCCCAATGATACAGAA
CCTAAGCTCACTTTAAGTACTTTGCACCAAGCAAAAGGATTAGAATGGAAAATAGTATTT
TTTATAGGGATAAATGATTAGCATTTTCCTGGAGAATTCATGAATTAGAGAACATTTAAA
CTATAAAAATTAGAAGAATGCAGGAGATTATTCTATGTTGGGTGTACAAGAGCTATTAAT
CAGCTTAATTTTTCTATTTTATAAAGGAAACCATAAGAAAAATGTCCTATAGTACAAAAT
ATTTTTTCATCTTATTAAAATAAATAAAATTTCATTTTTTTAATAGGTTTGTAGATTTTT
CAGTGAGATTGATTAATAATATTTTAAAGTAGATGAAAATATAAAAAAAGAAGATTTTGC
ACCTATATAAGGCCAAGGTAACAAACATATTTTTATTTATTATTAAGTTATTTATAAATT
ATTAAACAAAAAAAATTATTTTTAATCTTCAACTATTATTTAGTTCATACCATATAGGTT
GAACTAAGAAATTTCAACAACATATACTGTGAATCCTCATAAATTAAGAATATTGTCTGT
CCTCCCTATTTCAAAAGCTAAAAAATACTCTTAACATAAAAAAATTTTTATATCATAATT
AAACGTAACCTTAATATATAAGGATTGATAGTATATACTCATTTATTTATTTTATCTTTT
ACATATTTTTGGTTTTTTAAAAAAGAAAATTGCAGGCATAAAGGTTTGGAAAATTAGACT
TAAATAACTAAAATTATTGAAGAATTCAATTATCATGATTTAGAGAAAATAGATAAATAT
TTAAAAGATATTAAATTTTTTCTCAAGGAAGATATTCATAAAAAGCCAAGTTTTGATATA
AAGTAAATTGCAAAAAATAGACTTTCGGTGGATTTAGGGATTTATATTGATATGTAAATT
AATATTTTAAATTTGTAATAATTTCATTAATATTAATAATATTAGATTATTTTAAAGAAT
AATTGCTGAAAAATATAACTCTGTCTAAGGCTATACTTATAGTGATGCAGAGAAAGTCCT
TTTTTCTATAAATTGGGCTAATTAAAGGGCAGAGATTGTTTTTAAATACAAGCAATTTTT
TGAAAATAAGAATTTACAATTTGATTAGATAGAGGATTCAGATGAATTCATAGATGTAAT
TAATATGTTTTATATCGAAAAGAGTAAGCAAACCTTTAAACTTTAAGATAGAGAAATAAA
AGTTTTAAAAGATATCTATGAGGAATTAAAAAAATTTATGGCAAGAAATAATTTAAATTA
CAGGTAATAAATAATACTATGATTATTTAGCCATTTATTTTAACAATTTCTTTAAAATAA
ATATTAGCAACGTCAGCCATTTGTTAATTGAAGGAAAGAATGATCGAGTGCTTTAGTTTT
TTCCTGAAGATTTTGATGACAAACACATTTATATAGAAAGCTATAAAAAATATTGTAATC
CAAATTACTAAACTATGGATATTTTATATGATATTTACAATGTCAGCAAATGTGGCTAAT
TAGTAAATTTAATAAGAAGAAGTCTTTATAGAAACGATTTCTAGCTATTTAATCCAATAG
ATTTAAAATTAATTATTGATAAGTTTTTGGATTTTCTTAAAAAGTAAAATTTTAAAAAGA
TACAAGTTAAAAAAAGGGTAAAAGATGATAACTTAATTGGTGAAATAGATTTTATTGCAG
ATGATACTATTTTTGAAATTAAATCCTCTTCATCCTATGAAGTACAAAAAGAATACATTA
TACAGGTTATCTTTTGTTTTGAATTATTTTTAATACAAAAAAAATTTTGGTGCATATTTA
CTAAAAAAAGGATAACTCATATTTACTTTAAGAAATTCATATTTATTTTTGTAAATATGA
ATTATTCTTTTTTATAGTAAATAAAAATATATTTAAGAAATTTTAGGAAATAAAATATGA
AAAGAGCTAAATTATTTTGTTTTAAAAACATTAATTTATGTAATATTTATTTATGAGCTT
AACACATAAAAAAATAATTAAATAAAATTTAATGTTTTTTTGTTTAAATTAGTGTTTAGC
ATATGCATCATTGATGAGAAAATAGGGTGAAAAAATTAATTCAATTGCATTTTATAATCC
CCTGCAAGGATATACTTCATTTTATGATATCTCTAATTGGAATTAAGAAAATGAATTTTG
TGATTTCCTTTTTTAGACTTCTTTAAATAAAATTATAGAAAAATAATAATAAAGTTAAAG
CTTTACCAATGATCCACCAATTGATTAAAATGAATACATATTAATTGAAGAGGATTAGGA
AGACTCTTAAGATTGTATAGAAATATAAAGCGAAGAATTTAGAGATAATTATAATACATA
GCATTATATTGAGCAGCTCCAAGATTATGTGAAGAAAGATAACTCATGCAATGGCATATA
ATAATTAATAGAAGTAAGCGAGCACAAAATTAATGAAAAACTAGGGACAGAGTACAAAAA
ATTGCACTTTGTAGAAAAAATATCAAATGAATTAGAATTTTTGGAGTCAGGAAGTTAATT
TATAAGTTCAAATCAGAAAAATATAAATTAGTTACTGGAAAATAAATGTGAATTAGATTA
AAATCAAAGTGATTATCAAACTGAATAAAAGTCTTAAAAAATTCATTAAAAAAATGTAAG
TAATTTAGATTTTAGTGATACTGAATCAAATTATTCAAACAAGCAAAATTAAAATATTTC
GCTATCACCTAGTAGTTTAAATATAACTCCAATTAAATTAAGCTAAGCGATTTAGCCTGA
ATATGTTGTAATCGAAGATGATTAGGAATTAGACTTTTTAAATAATAGCAAAAATTTTGA
TAAAAGAACATTAAACGAAATGGAAAATGAAAGATAAATTCAGCAATAGTTGTTTGAATA
AAAATATTAAGAAAAGGTTAATTAAAATGTTAATTTATTTCTTGAATAGTTTTCTAACAA
AATTAATTATCAAAACTAAATAATAAATCAATAAAATTAAAACATCAATGAGTTATAAAA
CTGTTCAAACTTAAATCCAATAAAACTTAATAATGAAACTGGTTTAAATTAAAAAATAGG
TTAAAATAGTCAAGAGAGAGATATTGGCAATACAATTCCATTAATAAATGAAAAAATTCA
TAATAGAGAATAAAATTAATGTTTTTTCAACTGTAATGATTTAATATCTATTGAATCATC
TCATGAAAAAGAAGAAATTTAAAATAACGATGATATTTAATTTGAATAAGATTCCTTATC
ATCTGAGCTAGATATAATGTAGACCTCACAGTTATAAATTAATCCTATTAACTTATCTGA
AATTGATTTTATTTAATAATATGACTCTGAATCATAATTGAAAACAAGCAATATTGGCTG
TAAAAGACGAGATATTGAAGTTAAAAGTGAAAGTAAAAAAGGATATTCACAAGATGATGT
TGAAAACAAAGATCATTTAAAACAAAATTAATAAATCTATAAAGAAAATTTAAGTGAAAA
AAATTAAATATGTGACTAAATTTATGATCAAATTACATTTAGTTAATTATTCAATCACTC
AGACTCACATAAAAATAATTAAGAATATGAAAACAATAAAGAATAAGAGCAAGATATGAA
AGATTAAAAAGTCAGTATTTATTTTGAAGATAATCAAAAATAACCTTATGAACACTTTAT
AAATTGCAATTTGTCTATCCAGTGCTCTATTAATGACTAGTATATAAATAATCAATAATA
AAAATATGAAGATTTACCATAAATGAAACAAGATAACTCTGAGTAAGAATCATAGTCATA
ATAGTAATTTAATGACTAAAATGTTGAAAAATATATTATTGAAAGCTAATTATAAAATAA
ATAGAATACTGTAAATTTAAACAAATAATAATCATAATCTGGTCTAAAAATTGAAAGTTA
GTTTAATGTTTATGAATCAGAGATAAGTAAACAATTTTAGGTGGAATATAAAGAGTAATA
ATAAGATAACTATGGCTAGAGTGGTTAAAATAACTTATATTTGAGTAATTAGTCTAATAA
AACACAATAATAAATAGATAAAAGCGAATTTCAAACTAACTAGGAAAATTCTAAAAATAA
ATAAAATTTATAATAATTTAATCAAAATGGAAGCAAACTAAAATTGTAGAAAAGCAACTC
TGAAAATATTGGAAATGGTATGACGAATTTAATAGAAAACAATTAAATGTAAAAAAATTT
CAATAAGATAATATCTAATTTAGACAATTAAAATTAATTTTAAAATACAAAATAACTCAC
ACTTTAAAATATGGAATCATTTTAAATTTAAAACTATTAAAATGGATTTGAAAATCTTTA
AATAGCTAATAATTCAAATTATCATTAAAAAAATGACATTTAATTTTTGAATTAACAATA
TAATAAGAAAAATTATCATTTAGCTTCTCATGAAAATGATGAAATTAAAAACTTATAAAG
TCATCCATTACAAGGTAATTTTTTTAAATATATTTAAAATATTATATGAAGAAATTTAAT
CTTAATCTTGATCTAATTTGTTTTAATTTACAATTTAAATATTTTTGAACAATTTTATTT
ACTAAAAATATTTTATTCTATTAAAATTATAGGTGAAATTATAGAATATAATAATGAGAA
AAAAGAAATTGTAACATAAAAATGTTTAGAAGAAATACACTAATAAACTAATGTTGAGAA
TATTAATTTCCCTTAAAATTATTAAATTTAAAGATTTTAGAATATAAAAAATATATAAAA
CAGTAATTTAAAACAATTAAACAGCAAAAGAAAAGCGAATGAAACCATTCACTAATTACA
AAAAGAGTTTTAATAAGATATATAAAAGAAAATAAAAATTGAACCAAATTATGATATTAA
ACATACTCAAATAACATTTTGCAAAGAGCTTCTAATATTATTATCGCTCATTTGGTTTAC
ATTTATGCTTTTCAAAAATAAATAATTTTAATGA