Identifiers and Description

Gene Model Identifier

TTHERM_00490560

Standard Name

UDH3 (UvrD/REP-family DNA helicase 3)

Aliases

PreTt08361 | 60.m00158

Description

UvrD/REP helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00580 ) UvrD/REP helicase
  • ( TIGR01075 ) DNA helicase II
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01074 ) ATP-dependent DNA helicase Rep
  • ( TIGR01073 ) ATP-dependent DNA helicase PcrA
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF02890 ) Borrelia family of unknown function
  • ( TIGR02972 ) trimethylamine N-oxide reductase system, TorE

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00490560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.17.99824663097029e-79UvrD/REP helicase (1047 aa)
OxytrichaContig4754.0.g70.000005998506718272351UvrD/REP helicase N-terminal d
omain
SGDYJL092W0.00010003404299092957SRS2 DNA helicase and DNA-depe
ndent ATPase involved in DNA r
epair, needed for proper timin
g of commitment to meiotic rec
ombination and transition from
Meiosis I to II; blocks trinu
cleotide repeat expansion; aff
ects genome stability

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00490560(coding)
ATGGAACTTGGTAATTAATAATAAAAGCATGGGTAGTAATAAAATAACATTTTAAAGTAT
ACAAATGAGTAGCTAGAATTCATTCATGCTCCTAAAAACAGAGATATTAAGATAACTGCT
TGTGCTGGTTCTGGAAAAACATAATGTGTGCTAGAGTTTACAAAGTAAGCATTAAAGGAG
GGATTTAATCCTAAAGAAATTTGCATAACAACTTTCAATATTTAAGCAAGCAATGATATG
AAAAAAAGAGCTATTGAGTTGATGGGAAAATTTTAGGCTGATTAAATTGAAATCCTTAAC
TTTGATAAAATAATAACAAAATTTTTTAAAATGATTTAAAAATCTAAAAGCTAAAAAGAA
TTGAACAAATAAAATTAGAAAGAAAATAAAAATTAACAATCGATTGAACTGACTTTGGCT
GAAAAATAATTTCAGCTATATCAAGACTTATAAGACGAATCTCTTAGCAAGCATATCTTC
GAAAGCTATAAACTGATCATATTTGACGAATTTTAAGATATCAACTAATTGCAGTATGAA
ATCTTAATGTTATTTAAGAGAATTGGAAAATCAATCATAGTCGTTGTTGGAGATGATCTT
TAGAATATATATGAGTTTAGAGGATCAGATTATAAATTTTTAAAGTCCTAAATTATTGAA
GATATTAATAAAGAAAACAAAAAATTTTATGGAAATGAGAACTTCAACATGTTGGAATAT
AATCTTACAACTAACTTTAGATGCTCCTCGAAAATCACTGCTTTCGCAAATGATATAATT
AGGTCATTCTAATATATTAATTAAAACCCAATGCAGAGTTTTGAAGATTTGAAATGTTAC
TAGAATAAAAAATGTGATATAAAGCCAACTCTTGAACCATATAAAAGTTATAACGATATG
TTCAAAGACATTTACAATTTTATAACATCCAAAGTGTAAAACGAAGGCTTTTCTTACTCA
GATATAGCAATAATAAGTGCAACAAGTTTTCCTTTAAGGTAAATAGAATTGAAATTAGAA
TAGCACAATTTTAACCAGCCTGAAAAAGAAATACCATTTTGGAGCTTCGTTGGCAAAAAC
AAAGATTTTGATTACAGTTTTGAATATAAAGGTAATAAAGTCACTTTATTAACAGCTCAT
AAGTCGAAAGGGTTGGAATGGAAAGCTTTATTTTTCATTGGAATAAATGATGATTAATTT
CCAGAGGTATTTATAAGATAAGTAGGAAACTACAATCAAAAAATTGAAGAGATGAGGCGT
TTATTTTATGTTGGATCAACAAGAGCAGCTTAAATTTTGAAATTGAGTTATTTTTCAAAC
AATAACAGAAAAGCTTGTAGGTTTTTAGGTGCAATTGATAAAAATAATATTTAATTTAAA
GGTTAAACTTAAATTGCTTAAGAAAAAAATACCACAAATGCTAATCAAAAATAACTGTTA
GATAAATAAGTGAGAGAAATATTTGAAGAGATGTGTAATCCTTAGTATATTGTTTAACTT
TAAAAAACTGAAAAGTTTCTTTAAGAAGAATAATTTTATTTAGAAGAAATTTAATACATT
CACAAGCCTATGTTTTCAAGAAATTAAATCTAAAAAATATTTTTCAATTAATCTGAAGAA
ATCCTTTTTTCTTACATTGAAACGTAATTTTCTTATCCTATAATGAATTTTCTAATTTTT
AAATAATTAATACTCAATTTAACATTTTATCAATAAATCTAATAAAATATTATTTATAAA
TGA


>TTHERM_00490560(protein)
MELGNQQQKHGQQQNNILKYTNEQLEFIHAPKNRDIKITACAGSGKTQCVLEFTKQALKE
GFNPKEICITTFNIQASNDMKKRAIELMGKFQADQIEILNFDKIITKFFKMIQKSKSQKE
LNKQNQKENKNQQSIELTLAEKQFQLYQDLQDESLSKHIFESYKLIIFDEFQDINQLQYE
ILMLFKRIGKSIIVVVGDDLQNIYEFRGSDYKFLKSQIIEDINKENKKFYGNENFNMLEY
NLTTNFRCSSKITAFANDIIRSFQYINQNPMQSFEDLKCYQNKKCDIKPTLEPYKSYNDM
FKDIYNFITSKVQNEGFSYSDIAIISATSFPLRQIELKLEQHNFNQPEKEIPFWSFVGKN
KDFDYSFEYKGNKVTLLTAHKSKGLEWKALFFIGINDDQFPEVFIRQVGNYNQKIEEMRR
LFYVGSTRAAQILKLSYFSNNNRKACRFLGAIDKNNIQFKGQTQIAQEKNTTNANQKQLL
DKQVREIFEEMCNPQYIVQLQKTEKFLQEEQFYLEEIQYIHKPMFSRNQIQKIFFNQSEE
ILFSYIETQFSYPIMNFLIFKQLILNLTFYQQIQQNIIYK


>TTHERM_00490560(gene)
TTTGTTTCGGAAATAGAGGAAGAAAATAATATAAATATGGAACTTGGTAATTAATAATAA
AAGCATGGGTAGTAATAAAATAACATTTTAAAGTATACAAATGAGTAGCTAGAATTCATT
CATGCTCCTAAAAACAGAGATATTAAGATAACTGCTTGTGCTGGTTCTGGAAAAACATAA
TGTGTGCTAGAGTTTACAAAGTAAGCATTAAAGGAGGGATTTAATCCTAAAGAAATTTGC
ATAACAACTTTCAATATTTAAGCAAGCAATGATATGAAAAAAAGAGCTATTGAGTTGATG
GGAAAATTTTAGGCTGATTAAATTGAAATCCTTAACTTTGATAAAATAATAACAAAATTT
TTTAAAATGATTTAAAAATCTAAAAGCTAAAAAGAATTGAACAAATAAAATTAGAAAGAA
AATAAAAATTAACAATCGATTGAACTGACTTTGGCTGAAAAATAATTTCAGCTATATCAA
GACTTATAAGACGAATCTCTTAGCAAGCATATCTTCGAAAGCTATAAACTGATCATATTT
GACGAATTTTAAGATATCAACTAATTGCAGTATGAAATCTTAATGTTATTTAAGAGAATT
GGAAAATCAATCATAGTCGTTGTTGGTATAAATAAAAATATTATTAAATTAATTAATTAA
TTAATTTTTTTGTGATTTTATAGGAGATGATCTTTAGAATATATATGAGTTTAGAGGATC
AGATTATAAATTTTTAAAGTCCTAAATTATTGAAGATATTAATAAAGAAAACAAAAAATT
TTATGGAAATGAGAACTTCAACATGTTGGAATATAATCTTACAACTAACTTTAGATGCTC
CTCGAAAATCACTGCTTTCGCAAATGATATAATTAGGTCATTCTAATATATTAATTAAAA
CCCAATGCAGAGTTTTGAAGGTAAAATTTAAAATAATTTTATATTTTAGAAATTGAATTA
AATAATAAATATAAAGATTTGAAATGTTACTAGAATAAAAAATGTGATATAAAGCCAACT
CTTGAACCATATAAAAGTTATAACGATATGTTCAAAGACATTTACAATTTTATAACATCC
AAAGTGTAAAACGAAGGCTTTTCTTACTCAGATATAGCAATAATAAGTGCAACAAGTTTT
CCTTTAAGGTAAATAGAATTGAAATTAGAATAGCACAATTTTAACCAGCCTGAAAAAGAA
ATACCATTTTGGAGCTTCGTTGGCAAAAACAAAGATTTTGATTACAGTTTTGAATATAAA
GGTAATAAAGTCACTTTATTAACAGCTCATAAGTCGAAAGGGTTGGAATGGAAAGCTTTA
TTTTTCATTGGAATAAATGATGATTAATTTCCAGAGGTATTTATAAGATAAGTAGGAAAC
TACAATCAAAAAATTGAAGAGATGAGGCGTTTATTTTATGTTGGATCAACAAGAGCAGCT
TAAATTTTGAAATTGAGTTATTTTTCAAACAATAACAGAAAAGTAATAAAATAAATAAAT
ACTATTTAATTTATCTATCTATTTATTTATTTATTTATCTATCTATTTATTTATTAATTT
TAAAATAATTTTAAGGCTTGTAGGTTTTTAGGTGCAATTGATAAAAATAATATTTAATTT
AAAGGTTAAACTTAAATTGCTTAAGAAAAAAATACCACAAATGCTAATCAAAAATAACTG
TTAGATAAATAAGTGAGAGAAATATTTGAAGAGATGTGTAATCCTTAGTATATTGTTTAA
CTTTAAAAAACTGAAAAGTTTCTTTAAGAAGAATAATTTTATTTAGAAGAAATTTAATAC
ATTCACAAGCCTATGTTTTCAAGAAATTAAATCTAAAAAATATTTTTCAATTAATCTGAA
GAAATCCTTTTTTCTTACATTGAAACGTAATTTTCTTATCCTATAATGAATTTTCTAATT
TTTAAATAATTAATACTCAATTTAACATTTTATCAATAAATCTAATAAAATATTATTTAT
AAATGA