Identifiers and Description

Gene Model Identifier

TTHERM_00490530

Standard Name

UDH2 (UvrD/REP-family DNA helicase 2)

Aliases

PreTt08358 | 60.m00155

Description

UvrD/REP helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00490530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.18.999789881836428e-67UvrD/REP helicase (1047 aa)
SGDYOL095C0.00000039992052383199455HMI1 Mitochondrial inner membr
ane localized ATP-dependent DN
A helicase, required for the m
aintenance of the mitochondria
l genome; not required for mit
ochondrial transcription; has
homology to E. coli helicase u
vrD
OxytrichaContig18155.0.g480.0000020007268868677913UvrD/REP helicase N-terminal d
omain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00490530(coding)
ATGGAAATAGAAAAATAATCAAATCTAAATTCTAATAAGAAGGCTGAGTTCAGATTGACA
GATGAACAACTAAAATTCATTTTGGCTCCTAAAAACAGGGATATCAAGGTTACTGCTTGT
GCTGGATCAGGAAAGACAGAATGTGCGCTTTAATTCATCAAGAGTGCTATTGACGAAGGA
TAAGACCCTAGAAGTATAAGTATAACAACTTTCAACATTTAAGCTAGTGTTGATATGAAA
AAAAGAGCAATACAATTAATGGGAAAAGAAAATGCTAACAAAATTGAAATAATTAATTTT
GATAAAATAATTTTCAAGCTTTATAAACAAATTAAAAAAATAAAAAGCGCCATTAATAAT
GAATTGATTAATAATAACAAAAATAATAAATAAGTAATAGACATTACTTTAGTTGAAAAG
TAGTATGAAGTTTATCTCAATTTACAAGACTTGTCTTTTACTAAATACTTTTAAAGTAAG
AAACTCGTTGTTTTTGATGAATTTTAAGATATTAATTAATTGCATTATGACATCTTAATG
CTATTTAAAAAAGTTGGAAACTCAGTTCTAGTAGTCCTTGGAGATGAAGCTTAGAATATT
TACGAATTTAGAGGATCAAATTTTAAATACTTGAATTAAATTGTTGAAGATGTAAACAGA
GAAAATAAAAAAATTTATGGTAACGAGGATTACAACATGCTGGAATTCAAACTTACTACT
AATTTTAGATGCTCTTCTAAAATTACTGACTTTGCTAATGATATTATAAGATATTTTAAT
TTTAAGGATTTTAACTAAAATACTATGATCAGTTTTGAAGATTTGAATTATGGAAAAGAA
ATTAAAAAATGTGATGTTAAACCTAGTTTGATAGCCTATCCAAATTACAATAACTTAGTA
TAAGATATTATAATCTAAATCAATGTATTAATAAAAAACTATGGTTTTTCTTACAAAGAT
TTTGCTATAATTTCTCCAACTACTTTTACTCTATATTAAGTAGAACTATTTTTGCAAAAG
TATAATTATTTTGAACCTGAAACAGAAATTCCGTTTTGGAGTTTTATTGGAAAAAGTAAA
GAATTTGGTTACAAATATGAGTATTAAGCAGATAAAATCATGATTTTGACAGGTCATAAA
TCTAAAGGATTGCAATGGAAAGTAGTATTTGAAGTTGGGATGGAAGATAATTTGTTTCCG
CTTTCATTTTTAAGAAAGACCGAGCATGATCTTGATGAGTTCAATAAAGTAGAAGAATTA
AAGCGCTTGTTTTATGTTATGTCTACAAGAACTTCTTAATTTCTTTACATAAGCTATATA
TCTCATAATAATAATGATTAATTAAATTATCAAGCATGTAGATTTTTGAATGCAATAGAC
AAAAATAAAATAAATATAATTGGTTAAGCTAGAATTTATCCTGACACAAAAGATAGCATT
TACATAAATGAATAATAACTTTAATCACTCTATTTGCTATTTGAAGTAATGGTTAACATT
TAACATATCAATGAGCTGCACTATTCATAGAGATACATCTAACCAGAATACATTTCAATA
GAAAAATAAACACAATTACACAAAAGATTATTCTCAAAATAATACATCGAATAAATCTAT
TTCAATTAATCAGAAGAGATATTGTTTACTTATTTTGAAGTAATTTTGATAGAGAAAACT
TAAATGAATTTTAATAAAAACATACTTCAATATTCATTACTGAATTTAAAAAAAAAATAA
AATAAATATCAACTTACCAATTAATTTATAAAAACATTTGAATTAGCTTTAGATTAATTC
CTTGATAAAGATTTAAAAATAAATAGTAACAAATTCTAAATTTAATCACTTTATAAGGTA
TCCTGTTTGTATCAATCATTTAAATCTAGAAATATGATTTACAGATGTTTTTTATGTAAG
AATCCATTTTATTCCATGACAAAGGTGATAATTAAAAATTTAGAATTATTTGTAGACTAT
ATATTGAGATAAAATAATGGTTAATTGTTAGTACTTGATAGTATTGAGTATAATAAACAG
TAAGCAAAAATTTTTGATATGTTTTTAATTTCAACAGAAGACACTATTTTTGAGATCAAT
CAGTCATTTAAAAAAAACTAGACAATAGAAAAACAAAACTTTCTAAAAGTTTTAAGTAAA
GTTGCTATTCTTAAATTAAAATATGGCAGAGATATCAAAAAAATTGAGTTCTATAACCCT
ATCAAAGGAACTATTTTACAAATCTATCTTTAAAATTGGACATTTCATAAGGATATTATC
AATTTTATATTTTAATTTTAATCTAAACTAAAAGACTCCGATTAAAATATATCTTAAGAT
ATTTAAACTTAAAATTGCACATAATAGACATTATAAACAGTTCTTGTTGATTAAGGAGAT
ATTTCTTAAACCTTAGGAAATTCTTTAAAAATTTAAGAAAAAACTTTGAAAAGCTAAAAA
GATAATTTAAATATTAAAGAAGAGAACTCATCAGAAATCTTAAGAATATCCCAATAATAT
CAAAATTAATTAATTAACTAACTAAAATAATAATCTTCATAATCTAGTTTTGAAGATAAA
ATGAATTTTGATGCTCATATGACAAAATAAAATTAAAACTTACACATTGAAAATGCCAAA
ACCAGCAACAAATAACAAATTCTTATAAACTCTAAAAAAAATTAAAAGAGTTATGATTCT
TAATAAATAGATGAGAAAAATAATAAATTTCTAAATAAATTAATATGA


>TTHERM_00490530(protein)
MEIEKQSNLNSNKKAEFRLTDEQLKFILAPKNRDIKVTACAGSGKTECALQFIKSAIDEG
QDPRSISITTFNIQASVDMKKRAIQLMGKENANKIEIINFDKIIFKLYKQIKKIKSAINN
ELINNNKNNKQVIDITLVEKQYEVYLNLQDLSFTKYFQSKKLVVFDEFQDINQLHYDILM
LFKKVGNSVLVVLGDEAQNIYEFRGSNFKYLNQIVEDVNRENKKIYGNEDYNMLEFKLTT
NFRCSSKITDFANDIIRYFNFKDFNQNTMISFEDLNYGKEIKKCDVKPSLIAYPNYNNLV
QDIIIQINVLIKNYGFSYKDFAIISPTTFTLYQVELFLQKYNYFEPETEIPFWSFIGKSK
EFGYKYEYQADKIMILTGHKSKGLQWKVVFEVGMEDNLFPLSFLRKTEHDLDEFNKVEEL
KRLFYVMSTRTSQFLYISYISHNNNDQLNYQACRFLNAIDKNKINIIGQARIYPDTKDSI
YINEQQLQSLYLLFEVMVNIQHINELHYSQRYIQPEYISIEKQTQLHKRLFSKQYIEQIY
FNQSEEILFTYFEVILIEKTQMNFNKNILQYSLLNLKKKQNKYQLTNQFIKTFELALDQF
LDKDLKINSNKFQIQSLYKVSCLYQSFKSRNMIYRCFLCKNPFYSMTKVIIKNLELFVDY
ILRQNNGQLLVLDSIEYNKQQAKIFDMFLISTEDTIFEINQSFKKNQTIEKQNFLKVLSK
VAILKLKYGRDIKKIEFYNPIKGTILQIYLQNWTFHKDIINFIFQFQSKLKDSDQNISQD
IQTQNCTQQTLQTVLVDQGDISQTLGNSLKIQEKTLKSQKDNLNIKEENSSEILRISQQY
QNQLINQLKQQSSQSSFEDKMNFDAHMTKQNQNLHIENAKTSNKQQILINSKKNQKSYDS
QQIDEKNNKFLNKLI


>TTHERM_00490530(gene)
ATGGAAATAGAAAAATAATCAAATCTAAATTCTAATAAGAAGGCTGAGTTCAGATTGACA
GATGAACAACTAAAATTCATTTTGGCTCCTAAAAACAGGGATATCAAGGTTACTGCTTGT
GCTGGATCAGGAAAGACAGAATGTGCGCTTTAATTCATCAAGAGTGCTATTGACGAAGGA
TAAGACCCTAGAAGTATAAGTATAACAACTTTCAACATTTAAGCTAGTGTTGATATGAAA
AAAAGAGCAATACAATTAATGGGAAAAGAAAATGCTAACAAAATTGAAATAATTAATTTT
GATAAAATAATTTTCAAGCTTTATAAACAAATTAAAAAAATAAAAAGCGCCATTAATAAT
GAATTGATTAATAATAACAAAAATAATAAATAAGTAATAGACATTACTTTAGTTGAAAAG
TAGTATGAAGTTTATCTCAATTTACAAGACTTGTCTTTTACTAAATACTTTTAAAGTAAG
AAACTCGTTGTTTTTGATGAATTTTAAGATATTAATTAATTGCATTATGACATCTTAATG
CTATTTAAAAAAGTTGGAAACTCAGTTCTAGTAGTCCTTGGTAAAAAATTTATTACTATT
CAAATAATAAAATGTTTATATTTATTTTATAAAAATAGGAGATGAAGCTTAGAATATTTA
CGAATTTAGAGGATCAAATTTTAAATACTTGAATTAAATTGTTGAAGATGTAAACAGAGA
AAATAAAAAAATTTATGGTAACGAGGATTACAACATGCTGGAATTCAAACTTACTACTAA
TTTTAGATGCTCTTCTAAAATTACTGACTTTGCTAATGATATTATAAGATATTTTAATTT
TAAGGATTTTAACTAAAATACTATGATCAGTTTTGAAGGTAAAGTTTATAAGTTTTATTA
TTTTTAATATAAAATCAAATTTATTAAATAAATAACTAAGATTTGAATTATGGAAAAGAA
ATTAAAAAATGTGATGTTAAACCTAGTTTGATAGCCTATCCAAATTACAATAACTTAGTA
TAAGATATTATAATCTAAATCAATGTATTAATAAAAAACTATGGTTTTTCTTACAAAGAT
TTTGCTATAATTTCTCCAACTACTTTTACTCTATATTAAGTAGAACTATTTTTGCAAAAG
TATAATTATTTTGAACCTGAAACAGAAATTCCGTTTTGGAGTTTTATTGGAAAAAGTAAA
GAATTTGGTTACAAATATGAGTATTAAGCAGATAAAATCATGATTTTGACAGGTCATAAA
TCTAAAGGATTGCAATGGAAAGTAGTATTTGAAGTTGGGATGGAAGATAATTTGTTTCCG
CTTTCATTTTTAAGAAAGACCGAGCATGATCTTGATGAGTTCAATAAAGTAGAAGAATTA
AAGCGCTTGTTTTATGTTATGTCTACAAGAACTTCTTAATTTCTTTACATAAGCTATATA
TCTCATAATAATAATGATTAATTAAATGTATTTTAAATTTACAATAAAATTATTATTAAA
TCTATCTATCTATTTTTTTTAAGTATCAAGCATGTAGATTTTTGAATGCAATAGACAAAA
ATAAAATAAATATAATTGGTTAAGCTAGAATTTATCCTGACACAAAAGATAGCATTTACA
TAAATGAATAATAACTTTAATCACTCTATTTGCTATTTGAAGTAATGGTTAACATTTAAC
ATATCAATGAGCTGCACTATTCATAGAGATACATCTAACCAGAATACATTTCAATAGAAA
AATAAACACAATTACACAAAAGATTATTCTCAAAATAATACATCGAATAAATCTATTTCA
ATTAATCAGAAGAGATATTGTTTACTTATTTTGAAGTGTAATTTTAATTATTTTATTTTT
ATCACAAAAATTTACCCCCCTCTCATTATTGAAATAAATAGCAGTTAAATACTTCAAAAT
TCTTTGCTATGATAATTTTAATTTTAAAATTAAACATCCTCTTATTATAAAATAAATAAA
CTTTCATCTTTTTTTTAATTTTGTCTTTTAAATGAAATCCTTTCCATCCTAAGTTTAAAA
GGGCAGGGTTTGATAATACCTAAATAATTTTCTCCTTTTAATCTAATATAAATGGGTCTC
TTTTGTGAATCCCCTCCCCTGAAAGTTGAGATTGTGATTTTTTGAAGTTGAAAAAAATAA
TAATAAAAAAACTTACAAAATAATTTTGGCAATTATAAATGTTTTAAGGTTTACCCTTCA
ACTTATTTGGTAAATGCAAAAATCAAATTTTTTTATTATAAATTTAGTACGAGAGTTATT
ATTAATAATTTTAAAATACTTTAAATTGAATAAATAAGTAAAATATGAAGATGATATTGA
AATTTATTTTTAAATTAAATTAGGATTATTTTTAGAATTTTGATAGAGAAAACTTAAATG
AATTTTAATAAAAACATACTTCAATATTCATTACTGAATTTAAAAAAAAAATAAAATAAA
TATCAACTTACCAATTAATTTATAAAAACATTTGAATTAGCTTTAGATTAATTCCTTGAT
AAAGATTTAAAAATAAATAGTAACAAATTCTAAATTTAATCACTTTATAAGGTATCCTGT
TTGTATCAATCATTTAAATCTAGAAATATGATTTACAGATGTTTTTTATGTAAGAATCCA
TTTTATTCCATGACAAAGGTGATAATTAAAAATTTAGAATTATTTGTAGACTATATATTG
AGATAAAATAATGGTTAATTGTTAGTACTTGATAGTATTGAGTATAATAAACAGTAAGCA
AAAATTTTTGATATGTTTTTAATTTCAACAGAAGACACTATTTTTGAGATCAATCAGTCA
TTTAAAAAAAACTAGACAATAGAAAAACAAAACTTTCTAAAAGTAAATATTTCAATCTTC
ATTTTATTTAATAATTTTTTATTTTATTTAGGTTTTAAGTAAAGTTGCTATTCTTAAATT
AAAATATGGCAGAGATATCAAAAAAATTGAGTTCTATAACCCTATCAAAGGAACTATTTT
ACAAATCTATCTTTAAAATTGGACATTTCATAAGGATATTATCAATTTTATATTTTAATT
TTAATCTAAACTAAAAGACTCCGATTAAAATATATCTTAAGATATTTAAACTTAAAATTG
CACATAATAGACATTATAAACAGTTCTTGTTGATTAAGGAGATATTTCTTAAACCTTAGG
AAATTCTTTAAAAATTTAAGAAAAAACTTTGAAAAGCTAAAAAGATAATTTAAATATTAA
AGAAGAGAACTCATCAGAAATCTTAAGAATATCCCAATAATATCAAAATTAATTAATTAA
CTAACTAAAATAATAATCTTCATAATCTAGTTTTGAAGATAAAATGAATTTTGATGCTCA
TATGACAAAATAAAATTAAAACTTACACATTGAAAATGCCAAAACCAGCAACAAATAACA
AATTCTTATAAACTCTAAAAAAAATTAAAAGAGTTATGATTCTTAATAAATAGATGAGAA
AAATAATAAATTTCTAAATAAATTAATATGA