Identifiers and Description

Gene Model Identifier

TTHERM_00864890

Standard Name

UDH12 (UvrD/REP-family DNA helicase 12)

Aliases

PreTt29119 | 154.m00077 | 3751.m00423

Description

UvrD/REP helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00864890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.19.997093137033517e-262UvrD/REP helicase (1047 aa)
OxytrichaContig981.0.0.g230.000000009996807949091551UvrD/REP helicase N-terminal d
omain
SGDYJL092W0.0000007001298633766835SRS2 DNA helicase and DNA-depe
ndent ATPase involved in DNA r
epair, needed for proper timin
g of commitment to meiotic rec
ombination and transition from
Meiosis I to II; blocks trinu
cleotide repeat expansion; aff
ects genome stability

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00864890(coding)
ATGCTGAATAACTAAAATGATTATAAAGTTATTAAATACAAAAATAAATTTGGTGAGGAT
TGCGAACTAAGGCCAAGTGAAGAGTAATTGAAAATTATTACATCAGAATTAAGGCAAGAT
CAAAAGATTATTGCGTGTGCTGGTTCTGGAAAAACTACTACTTTAGTTGCTAGACTTAAA
TATTTGATAGATCACGGTGTTTCACCTGAATCAATCATCATTAGTACTTTCAATGTAGAA
GCTGGAAGAAATATTCAAAGTAGAGCGATGGAATTGATTGGAGAATAATCTGCTAAAAAA
TTAGATATTGGAAATATTGATAAAATAGCTTTCCGTCTTTATTTTTAATATATAAAAAAT
AGCTAAAATGCTTAGTTTAAGCAGTTTGGGCTTAGTGTGAAAGAGTATTGTTATGAATTA
TTTAAGTTTTTATAAACAAGAGATGGAATAAAATATGTTTTAGACAGATATAAATATTTC
TTTTTTGATGAGTTTTAAGATGTTAATTAACTACAATATGATATATTGATGCTATTTAAA
AAGCATGGATGCTTCTTAGTTGTTATAGGGGATGATGCTTAAAATATATATGGATGGAGA
GATTCGAGAATAGATATTATATAAACAAGAATCGATGAGGATATTAAAAAGTTTTAGGGA
GCTCACATTAAAACATATATGCTTTCTACTAACTATAGATGCTCAAAACCTATCACTTTA
TTTTCTAATTCTATTATAGCTACTTCTAAAAATTTGATTTAAAAAAGTATGAGATATTTA
GTCAAAGAAGAAGGAGTGATTGAACTTAAACCATACTTGTAATGCTTTAAAGGATTATAT
AATTAGAATGAAGAAATAATCTCTCAGATAAAAAGTAAACTTAAAAGATATTAACTAAAA
GATATAGCTATATTATGCTCAACAAATTAGCCACTCAAGTTTTTTGAAGAGGCTCTTGAA
AAGCATAACGAAAAAAGCAGTTTAAAACTGAATTATATGAGTATGATAGGCAATAACTCC
AGTATTTATGGAGGTAAAACCAACTAAAGCGAACTATTAAAATAAGATAGAATTACTTTA
AGCACTATACATAGGGCAAAAGGTCTCGAATGGAAAGTGGTATTTTTCATTGGTGTAAAT
GATGAGTTTTTTCCTAATAACTTCCTAAGAGATCCTTCCAACTCTCTTACCAGATTAGAA
GAATGTAGAAGATTGTTTTATGTAGGAGCTACAAGAGCCATAAATGAACTTTATTTCGCT
ATGGTTAAAAATAATAAATGTCATAAAGTATGTAGATTTTTTAGTGGAATCAATGCAGAA
TTATATGAAAGAGATATAGATATTACAGATAATGATATGATAGTCGAAGAAGAAAATATA
AAAAAGGATTTTGAAAGAGATGTCTAAGTGACTAAAATCATAGAGCAGATGGACCACAAA
GATTTAAGTGAAGCTGATTAATTTTTATAAAATGTGGAGGAATTAGAAATTCGTTAAATA
CATCCAAAGAGCAATTTAAATGAATCTGAAATAAGAAATAATAACTTGTTTGTAGATTTA
GGTTTATATATCGACTTGCTAATATAAAGAACTCTTGCAGAATAGCTCAATGCTGAAAAC
GGTTACTCTTATGAATATGCTTAGATAGTTCTATTTTCTATTTTTTGGAGATCAGATAAG
GCAGAATTTATTTCAAAATATAGCACTTTTTTTAACAATAAAATGCTTGATTTCTCCGAT
ATTGAAGATGAAGAGGATTTCATAGAGGCATTCAATTTATTCTATAAATTTGGAAAAGTA
GATAGAATTTAGTAAAACATAAAACTCAATGGATTTGAAATTTAAACCCTTAGTACTATT
TACTAAATATTGAAAGAGTATACACAAAAATACAATATAGAATACAGTGTTATCACTCAC
TAAGTCGAGGAATTAAATGCCATAGCTAAAGAGTATTTTCCTGAAGATTATAATAAAGAA
CCTTATATGAATAGTTATAAAAAGTTTATGAATCCTTAATTAAAATGTAACAATATACTT
TTTGATATTTATTAAGTCAGTAAATGTGGTCAGTTATTTGATATGACTAGGAGAGTCCTT
TATAGGAATGATTTTTAAACTCTGAACCCTAAAAATATTTAAGATAACTTGAATAATTTT
GTAAAATACCTTTAATCTTTTAACTATGAGAAGATAAAAGTAAAATCAGTCATAACTCAT
GGCTTAAACTTAAAAGGAGAAATAGATTTACTAGCAGATGATACAATATATGAAATAAAG
GCTTCTTAGTTTTAATCTATCTCAAAGGAGTATATTCTCTAAGTAAATACTAATTTTTTT
CTTTTTATTTTTTAGTTTTTAAATTTACTTTTTTAGGTTTTAGCCTATGCAGCTTTGCTT
AGGGTTGCACAAAATGTAGAAGTCAATCATATTGTATTTTATAACCCTTTAATTGGAAAG
ATATATAAATATAGTATCTCTAATTGGCCTTATGCTTAGTAATACATTAAATTCTTAACT
GATAAATCACTGTAACTAGCTAATTCAAAGAAAAAAGTACTTGAACAAAGTGAGGCTGAA
GAAAAATAACAACTAGTTAACTTGAATCAAAATAAAGCAAATAATTCTCAGTAAAATAAT
AACTAAGATAAGACCTAGGACACAAATAGTCAAACTACTAATTTTAATGAAATTGGTGAT
TTAATTTAGTAAAAACTTCAGGAGGAAAAATTATAGTCGAAGCCATTATTTAATGTATCT
GAATTCAGCTAACCATAAAACAGGCCAAGATCTCTATTTACAAAACAAACTGTTTCAATA
AAATCATCAACTGAATAAAAAAGCACAAGCACTGTATCTGGATATAGAAATTAGGTTCCA
GATTAGGGAGAAAACAAAAAGCCAAAAAATGTTTATAGAGACTTTAAGAAATTTGTAAAG
AATGAATAAATTGCATTATTAAAATAAAATATAAAATAAACTAAAATAATTGTAGAAAGT
GATCAAAGCTCTGAAAACGATGACATAGAAGAATATTCTTCTCTTAATATCAAAAAAATT
AGCAAAAATTAAATTTCTAGTTCTAATCTATAAAAAAATGTACTTCCGAAATCTACTCAG
AATATTTTATCATAATTAGATGATATTGAAGAAGTTTCTTCCAAATTTATATAAATAGAC
TGA


>TTHERM_00864890(protein)
MLNNQNDYKVIKYKNKFGEDCELRPSEEQLKIITSELRQDQKIIACAGSGKTTTLVARLK
YLIDHGVSPESIIISTFNVEAGRNIQSRAMELIGEQSAKKLDIGNIDKIAFRLYFQYIKN
SQNAQFKQFGLSVKEYCYELFKFLQTRDGIKYVLDRYKYFFFDEFQDVNQLQYDILMLFK
KHGCFLVVIGDDAQNIYGWRDSRIDIIQTRIDEDIKKFQGAHIKTYMLSTNYRCSKPITL
FSNSIIATSKNLIQKSMRYLVKEEGVIELKPYLQCFKGLYNQNEEIISQIKSKLKRYQLK
DIAILCSTNQPLKFFEEALEKHNEKSSLKLNYMSMIGNNSSIYGGKTNQSELLKQDRITL
STIHRAKGLEWKVVFFIGVNDEFFPNNFLRDPSNSLTRLEECRRLFYVGATRAINELYFA
MVKNNKCHKVCRFFSGINAELYERDIDITDNDMIVEEENIKKDFERDVQVTKIIEQMDHK
DLSEADQFLQNVEELEIRQIHPKSNLNESEIRNNNLFVDLGLYIDLLIQRTLAEQLNAEN
GYSYEYAQIVLFSIFWRSDKAEFISKYSTFFNNKMLDFSDIEDEEDFIEAFNLFYKFGKV
DRIQQNIKLNGFEIQTLSTIYQILKEYTQKYNIEYSVITHQVEELNAIAKEYFPEDYNKE
PYMNSYKKFMNPQLKCNNILFDIYQVSKCGQLFDMTRRVLYRNDFQTLNPKNIQDNLNNF
VKYLQSFNYEKIKVKSVITHGLNLKGEIDLLADDTIYEIKASQFQSISKEYILQVNTNFF
LFIFQFLNLLFQVLAYAALLRVAQNVEVNHIVFYNPLIGKIYKYSISNWPYAQQYIKFLT
DKSLQLANSKKKVLEQSEAEEKQQLVNLNQNKANNSQQNNNQDKTQDTNSQTTNFNEIGD
LIQQKLQEEKLQSKPLFNVSEFSQPQNRPRSLFTKQTVSIKSSTEQKSTSTVSGYRNQVP
DQGENKKPKNVYRDFKKFVKNEQIALLKQNIKQTKIIVESDQSSENDDIEEYSSLNIKKI
SKNQISSSNLQKNVLPKSTQNILSQLDDIEEVSSKFIQID


>TTHERM_00864890(gene)
ATGCTGAATAACTAAAATGATTATAAAGTTATTAAATACAAAAATAAATTTGGTGAGGAT
TGCGAACTAAGGCCAAGTGAAGAGTAATTGAAAATTATTACATCAGAATTAAGGCAAGAT
CAAAAGATTATTGCGTGTGCTGGTTCTGGAAAAACTACTACTTTAGTTGCTAGACTTAAA
TATTTGATAGATCACGGTGTTTCACCTGAATCAATCATCATTAGTACTTTCAATGTAGAA
GCTGGAAGAAATATTCAAAGTAGAGCGATGGAATTGATTGGAGAATAATCTGCTAAAAAA
TTAGATATTGGAAATATTGATAAAATAGCTTTCCGTCTTTATTTTTAATATATAAAAAAT
AGCTAAAATGCTTAGTTTAAGCAGTTTGGGCTTAGTGTGAAAGAGTATTGTTATGAATTA
TTTAAGTTTTTATAAACAAGAGATGGAATAAAATATGTTTTAGACAGATATAAATATTTC
TTTTTTGATGAGTTTTAAGATGTTAATTAACTACAATATGATATATTGATGCTATTTAAA
AAGCATGGATGCTTCTTAGTTGTTATAGGTAAATTAATCATTAAAAAGTCTTAAAATATC
TCATTTATATTTTGAAGATAAAAGAACAAGCATAAAATAATATATTCTAAATAAATAAAA
GTGTTTAATTAATTAATTGTTTTATTAGGGGATGATGCTTAAAATATATATGGATGGAGA
GATTCGAGAATAGATATTATATAAACAAGAATCGATGAGGATATTAAAAAGTTTTAGGGA
GCTCACATTAAAACATATATGCTTTCTACTAACTATAGATGCTCAAAACCTATCACTTTA
TTTTCTAATTCTATTATAGCTACTTCTAAAAATTTGATTTAAAAAAGTATGAGATATTTA
GTCAAAGAAGAAGGTAAATAATATCTATTAGTTGAGTAGAATTAAAAAAATAAAACCCTT
TTTTAATTAATAATAGGAGTGATTGAACTTAAACCATACTTGTAATGCTTTAAAGGATTA
TATAATTAGAATGAAGAAATAATCTCTCAGATAAAAAGTAAACTTAAAAGATATTAACTA
AAAGATATAGCTATATTATGCTCAACAAATTAGCCACTCAAGTTTTTTGAAGAGGCTCTT
GAAAAGCATAACGAAAAAAGCAGTTTAAAACTGAATTATATGAGTATGATAGGCAATAAC
TCCAGTATTTATGGAGGTAAAACCAACTAAAGCGAACTATTAAAATAAGATAGAATTACT
TTAAGCACTATACATAGGGCAAAAGGTCTCGAATGGAAAGTGGTATTTTTCATTGGTGTA
AATGATGAGTTTTTTCCTAATAACTTCCTAAGAGATCCTTCCAACTCTCTTACCAGATTA
GAAGAATGTAGAAGATTGTTTTATGTAGGAGCTACAAGAGCCATAAATGAACTTTATTTC
GCTATGGTTAAAAATAATAAATGTCATAAAGTAAAAGCATAATAAATTAATTATTTAAAA
AGCATTCATTCAAAAAAATAAATATAAATAAAAAGGTATGTAGATTTTTTAGTGGAATCA
ATGCAGAATTATATGAAAGAGATATAGATATTACAGATAATGATATGATAGTCGAAGAAG
GTATCTAATATTTCATTTTTTTATGTTTTAAAGAGACATTTAAAGTTTAACTTTTAGATT
TTAAAATGAAATAATCTAATTTAATTTAATTAATTTTGAAAAAAATTTCCAAAAAATTAT
TAACTTTTATGAAGAAAATATAAAAAAGGATTTTGAAAGAGATGTCTAAGTGACTAAAAT
CATAGAGCAGATGGACCACAAAGATTTAAGTGAAGCTGATTAATTTTTATAAAATGTGGA
GGAATTAGAAATTCGTTAAATACATCCAAAGAGCAATTTAAATGAATCTGAAATAAGAAA
TAATAACTTGTTTGTAGATTTAGGTTTATATATCGACTTGTAGTTTATCTTTATTGTTAT
ATATTTTTGATTTCTTTCTATTATAAAATTTAGGCTAATATAAAGAACTCTTGCAGAATA
GCTCAATGCTGAAAACGGTTACTCTTATGAATATGCTTAGATAGTTCTATTTTCTATTTT
TTGGAGATCAGATAAGGCAGAATTTATTTCAAAATATAGCACTTTTTTTAACAATAAAAT
GCTTGATTTCTCCGATATTGAAGATGAAGAGGATTTCATAGAGGCATTCAATTTATTCTA
TAAATTTGGAAAAGTAGATAGAATTTAGTAAAACATAAAACTCAATGGATTTGAAATTTA
AACCCTTAGTACTATTTACTAAATATTGAAAGAGTATACACAAAAATACAATATAGAATA
CAGGTAGGATTTTATTTGAATTAATTTATTTTTATTACTTTTTAATGTTATTTTTATTTA
GTGTTATCACTCACTAAGTCGAGGAATTAAATGCCATAGCTAAAGAGTATTTTCCTGAAG
ATTATAATAAAGAACCTTATATGAATAGTTATAAAAAGTTTATGAATCCTTAATTAAAAT
GTAACAATATACTTTTTGATATTTATTAAGTCAGTAAATGTGGTCAGTTATTTGATATGA
CTAGGAGAGTCCTTTATAGGAATGATTTTTAAACTCTGAACCCTAAAAATATTTAAGATA
ACTTGAATAATTTTGTAAAATACCTTTAATCTTTTAACTATGAGAAGATAAAAGTAAAAT
CAGTCATAACTCATGGCTTAAACTTAAAAGGAGAAATAGATTTACTAGCAGATGATACAA
TATATGAAATAAAGGCTTCTTAGTTTTAATCTATCTCAAAGGAGTATATTCTCTAAGTAA
ATACTAATTTTTTTCTTTTTATTTTTTAGTTTTTAAATTTACTTTTTTAGGTTTTAGCCT
ATGCAGCTTTGCTTAGGGTTGCACAAAATGTAGAAGTCAATCATATTGTATTTTATAACC
CTTTAATTGGAAAGATATATAAATATAGTATCTCTAATTGGCCTTATGCTTAGTAATACA
TTAAATTCTTAACTGATAAATCACTGTAACTAGCTAATTCAAAGAAAAAAGTACTTGAAC
AAAGTGAGGCTGAAGAAAAATAACAACTAGTTAACTTGAATCAAAATAAAGCAAATAATT
CTCAGTAAAATAATAACTAAGATAAGACCTAGGACACAAATAGTCAAACTACTAATTTTA
ATGAAATTGGTGATTTAATTTAGTAAAAACTTCAGGAGGAAAAATTATAGTCGAAGCCAT
TATTTAATGTATCTGAATTCAGCTAACCATAAAACAGGCCAAGATCTCTATTTACAAAAC
AAACTGTTTCAATAAAATCATCAACTGAATAAAAAAGCACAAGCACTGTATCTGGATATA
GAAATTAGGTTCCAGATTAGGGAGAAAACAAAAAGCCAAAAAATGTTTATAGAGACTTTA
AGAAATTTGTAAAGAATGAATAAATTGCATTATTAAAATAAAATATAAAATAAACTAAAA
TAATTGTAGAAAGTGATCAAAGCTCTGAAAACGATGACATAGAAGAATATTCTTCTCTTA
ATATCAAAAAAATTAGCAAAAATTAAATTTCTAGTTCTAATCTATAAAAAAATGTACTTC
CGAAATCTACTCAGAATATTTTATCATAATTAGATGATATTGAAGAAGTTTCTTCCAAAT
TTATATAAATAGACTGA