Identifiers and Description

Gene Model Identifier

TTHERM_00888060

Standard Name

UDH11 (UvrD/REP-family DNA helicase 11)

Aliases

PreTt23316 | 158.m00072

Description

UvrD/REP helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00580 ) UvrD/REP helicase
  • ( TIGR01075 ) DNA helicase II
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01074 ) ATP-dependent DNA helicase Rep
  • ( TIGR01073 ) ATP-dependent DNA helicase PcrA
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF03205 ) Molybdopterin guanine dinucleotide synthesis protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00888060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.17.002185723491005e-79UvrD/REP helicase (1047 aa)
OxytrichaContig18155.0.g480.00000008001913847069386UvrD/REP helicase N-terminal d
omain
SGDYOL095C0.0000007001298633766835HMI1 Mitochondrial inner membr
ane localized ATP-dependent DN
A helicase, required for the m
aintenance of the mitochondria
l genome; not required for mit
ochondrial transcription; has
homology to E. coli helicase u
vrD

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00888060(coding)
ATGGAAGATAAAAATATCAAGAATAAATCATTTGAATATACTTAGTAGTAAAAAGAGTTT
ATTTATGCATCTAAAAGAAGAGATATCAAGGTAACTGCTTGCGCTGGATCTGGAAAAACT
TAATGTGTTCTTATGTATGTAAAAGAGGCCATAGATGAAGGATTTGATCCTTCTGCTATC
TGTATCACAACTTTTAATATTTAAGCCAGCAATGATATGAAAAAGAGAGCAGTATAGTTA
ATAGGAAAAGACAAAGCTGATAAAATCGAAATCACTAATATTGATAAGCTAATTACTAAG
CTCTTTAATAGTATTTAGAGAGCAAAAAAACAAAAAGATAATGAAAAATAAAAAAATGAA
ATTGAAAAAGAATTATTAATAGATATCACTTTAGTTGAAAAACAAAGCTAAGTTTATGAA
GATTTGTAAGATTTGTCTCTTAGTAAAGAGATTTTTGAAAAGTACAAAATTATTATTTTC
GATGAATTTTAAGACATAAACTAATTATAATATGACATATTTATGCTCTTTAAAAAAATT
GGAGAATCAATTTTGGTAGTCGTTGGAGATGATGCTTAGAATATTTACGAGTTCAGAGGA
TCAAATTATGAATTCTTGAGATCTAAAGTAATTGAAGATGTAAACAGAGAAAACAAAAGA
ATTTATGGCAGTGAAGATTACACCATGCTTGACATTAAGCTCACAACTAATTTTAGATGC
TCTTCAAAGATTACTAAGTTTGCAAATGACATTATTAAATCTTTTAATATTATCTAGTAA
AATACAATGTAGAGCTATGAAGACTTAGAGGGATACAAAAACGAGAAAAGCTAGGTAAAA
CCAACCCTGGAATCATATAAAAGCTATAATGATTAGTTTAATAGTATTTTAACTTAAATA
TAAACTTTCATAAACTAAGGTTATAGTTATGAGGATATTGCTATTATTTGCCCTAAAGGA
TCACTCTTGAGAGATATAGAATACAAATTAGAAAAGCATAATAGTTTTAAATCAGATTAA
ATACCTTTTTGGAGTTTCATAGGAAAAAATAATGATTTTGATTTTAAATATGAATACAAA
GGAAATAAAGTTACTTTATTGACTATACACAAATCTAAGGGATTAGAATGGAAAGTTTTG
TTTTTCGTCGGACTAAATGATGATTAATTTCCAAAGGCTTTTTTGAAATAAAAAAATAAC
TAGGATCGTTAAATAGAAGAAATGACACGTTTGTTCTATGTTGGATCAACAAGAGCAGCT
AAAATTCTTAATATGAGTTACTTTTCATATCCTTAGAGATGTGCTTGCAGATTTTTGAGC
AAAATAAACGAAAATTACATGGAATTTAAAGGAGATATTGCTATTTTTGATGGAAAATAA
TGCAACCCAATTTTGTCATCTATTTTAAAAAGCTAAGATTCGAATTATAATAATGTTAAT
AATTCAGGTAAATAAATAAGTGAAATTTTTGAAGAAATGAGCAATGCTTAACACTTAAAA
GAACTAGAGTTTTCTTAAAAAAAATATCTTTAAGAAAAATATTTTGAGCTAGAAGAAGTA
TACAAAGTACATGAACAAATGTTTACTAAATAATAAATATAAAACTTCTTTTTCCATTAA
TCAGTAGAGTTATTGTTTACTTACTTAGAAACAATTACTTTATGGATTATGTAACATGAA
GTCAAAATAGAGTCTAGATCGTTAATTCTAAATGAATAGAAAATTTAAATAGATTAGCTA
TCTGCAAATTCAAAAAAGCTTTAAATCTCTGAATTATAAATTTAATCTTTTAAAAATGCA
TTCATATAATTTTTAAAAATTGATAAAAAAACAAATCAAAGTGAAGAACTAATTGAAGCT
TTTTTCAAAGTTTCTCTTTTATATGAAATTTCAAAAAGTAAAAATCAGATCTATAAATAT
CTTTATAAAAAGAACATTTTTTCTTCTTTGACTAAAACTCCAATTATAGAATGCTTAGAT
CTATTTGTTAAGTATGTGAAGACATAAGAAAGTGAGGAAATTCTTATATTAGATAAGATA
TAAGATAAATCTGATTTTGATCCTGATAGAACTTTTGATTATTTTACTATATCAGGCAAA
GAAACTCTTTATGAAATCAGTTAATCATTCAAAAAAACTAAGAAAATACAAAAACAAGTT
ATGTTAACAGTTTTAGCCAAAATTTCAATATTGAAGAAGAAATATGGTAAAGATATCAAA
AAAGTCAAGTTTTATAATCCTATAAAAGGAACGGTTTTTTCAGTTTTGATAAAAGATTGG
TAACTTCATTCAGACTTTATAGATTTTATGGAGAAATTTAATGAAAAACTTAAAAACCCT
TAGTAAACAAATTGA


>TTHERM_00888060(protein)
MEDKNIKNKSFEYTQQQKEFIYASKRRDIKVTACAGSGKTQCVLMYVKEAIDEGFDPSAI
CITTFNIQASNDMKKRAVQLIGKDKADKIEITNIDKLITKLFNSIQRAKKQKDNEKQKNE
IEKELLIDITLVEKQSQVYEDLQDLSLSKEIFEKYKIIIFDEFQDINQLQYDIFMLFKKI
GESILVVVGDDAQNIYEFRGSNYEFLRSKVIEDVNRENKRIYGSEDYTMLDIKLTTNFRC
SSKITKFANDIIKSFNIIQQNTMQSYEDLEGYKNEKSQVKPTLESYKSYNDQFNSILTQI
QTFINQGYSYEDIAIICPKGSLLRDIEYKLEKHNSFKSDQIPFWSFIGKNNDFDFKYEYK
GNKVTLLTIHKSKGLEWKVLFFVGLNDDQFPKAFLKQKNNQDRQIEEMTRLFYVGSTRAA
KILNMSYFSYPQRCACRFLSKINENYMEFKGDIAIFDGKQCNPILSSILKSQDSNYNNVN
NSGKQISEIFEEMSNAQHLKELEFSQKKYLQEKYFELEEVYKVHEQMFTKQQIQNFFFHQ
SVELLFTYLETITLWIMQHEVKIESRSLILNEQKIQIDQLSANSKKLQISELQIQSFKNA
FIQFLKIDKKTNQSEELIEAFFKVSLLYEISKSKNQIYKYLYKKNIFSSLTKTPIIECLD
LFVKYVKTQESEEILILDKIQDKSDFDPDRTFDYFTISGKETLYEISQSFKKTKKIQKQV
MLTVLAKISILKKKYGKDIKKVKFYNPIKGTVFSVLIKDWQLHSDFIDFMEKFNEKLKNP
QQTN


>TTHERM_00888060(gene)
ATGGAAGATAAAAATATCAAGAATAAATCATTTGAATATACTTAGTAGTAAAAAGAGTTT
ATTTATGCATCTAAAAGAAGAGATATCAAGGTAACTGCTTGCGCTGGATCTGGAAAAACT
TAATGTGTTCTTATGTATGTAAAAGAGGCCATAGATGAAGGATTTGATCCTTCTGCTATC
TGTATCACAACTTTTAATATTTAAGCCAGCAATGATATGAAAAAGAGAGCAGTATAGTTA
ATAGGAAAAGACAAAGCTGATAAAATCGAAATCACTAATATTGATAAGCTAATTACTAAG
CTCTTTAATAGTATTTAGAGAGCAAAAAAACAAAAAGATAATGAAAAATAAAAAAATGAA
ATTGAAAAAGAATTATTAATAGATATCACTTTAGTTGAAAAACAAAGCTAAGTTTATGAA
GATTTGTAAGATTTGTCTCTTAGTAAAGAGATTTTTGAAAAGTACAAAATTATTATTTTC
GATGAATTTTAAGACATAAACTAATTATAATATGACATATTTATGCTCTTTAAAAAAATT
GGAGAATCAATTTTGGTAGTCGTTGGTATTATTCTATTTATTTTAGTTACATCAATAATT
GACTTAAACTTTAAATGAAAAATAGGAGATGATGCTTAGAATATTTACGAGTTCAGAGGA
TCAAATTATGAATTCTTGAGATCTAAAGTAATTGAAGATGTAAACAGAGAAAACAAAAGA
ATTTATGGCAGTGAAGATTACACCATGCTTGACATTAAGCTCACAACTAATTTTAGATGC
TCTTCAAAGATTACTAAGTTTGCAAATGACATTATTAAATCTTTTAATATTATCTAGTAA
AATACAATGTAGAGCTATGAAGGTAAATTTATTTTCTAGATTAAAAACTAATTTAATTCA
ATTCACAAAAGACTTAGAGGGATACAAAAACGAGAAAAGCTAGGTAAAACCAACCCTGGA
ATCATATAAAAGCTATAATGATTAGTTTAATAGTATTTTAACTTAAATATAAACTTTCAT
AAACTAAGGTTATAGTTATGAGGATATTGCTATTATTTGCCCTAAAGGATCACTCTTGAG
AGATATAGAATACAAATTAGAAAAGCATAATAGTTTTAAATCAGATTAAATACCTTTTTG
GAGTTTCATAGGAAAAAATAATGATTTTGATTTTAAATATGAATACAAAGGAAATAAAGT
TACTTTATTGACTATACACAAATCTAAGGGATTAGAATGGAAAGTTTTGTTTTTCGTCGG
ACTAAATGATGATTAATTTCCAAAGGCTTTTTTGAAATAAAAAAATAACTAGGATCGTTA
AATAGAAGAAATGACACGTTTGTTCTATGTTGGATCAACAAGAGCAGCTAAAATTCTTAA
TATGAGTTACTTTTCATATCCTTAGAGATGTGTAATAAATAATTCTATTTTACAATTTTA
CTCACTCACTTATTATATAAAAATTAGGCTTGCAGATTTTTGAGCAAAATAAACGAAAAT
TACATGGAATTTAAAGGAGATATTGCTATTTTTGATGGAAAATAATGCAACCCAATTTTG
TCATCTATTTTAAAAAGCTAAGATTCGAATTATAATAATGTTAATAATGTAAAATAATCT
AATTTAAATTATTGGATAAAAATCATAATAAAATTATTAGTCAGGTAAATAAATAAGTGA
AATTTTTGAAGAAATGAGCAATGCTTAACACTTAAAAGAACTAGAGTTTTCTTAAAAAAA
ATATCTTTAAGAAAAATATTTTGAGCTAGAAGAAGTATACAAAGTACATGAACAAATGTT
TACTAAATAATAAATATAAAACTTCTTTTTCCATTAATCAGTAGAGTTATTGTTTACTTA
CTTAGAAACGTAATTCATTAAATTATTAATTTCTTCTATCTTTAGATTTTATAAATTTAA
TTCACCGCAATTCCATTTATCTTCTCTCATCCTTTTATGCCACTAATATAAATTTATAAA
TTAAAATGCTAACTTGGATATTCCATTTTTTTAGATCAAACTAATTAGTCTATTATTAAT
GCTATTAATATTATATTCTTAGTTTATTTGCTATTATTGCTAATTCATATTTAAATACTT
TTTTAATTTTTTTTCACTAAAATATTTCTAAACAAATTATTATATTTTTTTGTTAATAAA
TTATATTTTCTTCATTTTTAAATTTTTTATTAGTATTTTTGAAAAATTAAGTTTTTCCTG
TGATCTTAAATATTTTAAATTGGAAAAAATCAAACATTTTTGATTGAATGAGGAAGGAAA
TAAGGTATTTTTCATTAATTTTGAAATCAAAAAATTTAATTTTAATTATTCATAAAATGC
TTATATTAAATTTAAAAAATAGAATTACTTTATGGATTATGTAACATGAAGTCAAAATAG
AGTCTAGATCGTTAATTCTAAATGAATAGAAAATTTAAATAGATTAGCTATCTGCAAATT
CAAAAAAGCTTTAAATCTCTGAATTATAAATTTAATCTTTTAAAAATGCATTCATATAAT
TTTTAAAAATTGATAAAAAAACAAATCAAAGTGAAGAACTAATTGAAGCTTTTTTCAAAG
TTTCTCTTTTATATGAAATTTCAAAAAGTAAAAATCAGATCTATAAATATCTTTATAAAA
AGAACATTTTTTCTTCTTTGACTAAAACTCCAATTATAGAATGCTTAGATCTATTTGTTA
AGTATGTGAAGACATAAGAAAGTGAGGAAATTCTTATATTAGATAAGATATAAGATAAAT
CTGATTTTGATCCTGATAGAACTTTTGATTATTTTACTATATCAGGCAAAGAAACTCTTT
ATGAAATCAGTTAATCATTCAAAAAAACTAAGAAAATACAAAAACAAGTTATGTTAACAG
TATAAAATTAAATATTAAATGATATATTTTTTACTAATTTAATTTATTTATTTAAAAAAG
GTTTTAGCCAAAATTTCAATATTGAAGAAGAAATATGGTAAAGATATCAAAAAAGTCAAG
TTTTATAATCCTATAAAAGGAACGGTTTTTTCAGTTTTGATAAAAGATTGGTAACTTCAT
TCAGACTTTATAGATTTTATGGAGAAATTTAATGAAAAACTTAAAAACCCTTAGTAAACA
AATTGA