Identifiers and Description

Gene Model Identifier

TTHERM_00723610

Standard Name

UDH10 (UvrD/REP-family DNA helicase 10)

Aliases

PreTt18121 | 116.m00146 | 3671.m00070

Description

UDH10 UvrD/REP family helicase; UvrD/REP helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00723610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14835.19.997093137033517e-262hypothetical protein (1478 aa)
SGDYOL095C0.0000000010002658722841845HMI1 Mitochondrial inner membr
ane localized ATP-dependent DN
A helicase, required for the m
aintenance of the mitochondria
l genome; not required for mit
ochondrial transcription; has
homology to E. coli helicase u
vrD

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00723610(coding)
ATGAAATAAACTAAAATAAAATAAGTTTAAGGTTAGGCTTCATTAAAAAGTTTTTTTAAA
CCTAAAAACGCAGATGTTTAGGATGATATTTAGACTGAAAATAAAGAAAATACAATCTAT
TAATAGAATTTAAAAATAGATATCAAAGTGGAAGATGATGGATTCTATCAGCAATAAATT
GATAACAATTTAAATTCTGTATAAAATCCTAGTTTTGAATAAAATGATGCTTAGGAATAC
GAAAATAGTTATGATATTTTACAAAAAAGGGAGGAATACATCAAAAAAAAATTAAGTCCT
TTCAAATACAGTAAAAAAAAATCATTCAAATCAAAAGTTAAAGCTAAAATAGGGTAAGAT
GATAGTTGTTCATCTCCTCTCAATAAAAAAAGAATGAAATAATCATCAAAATGGATTAGA
ATGACACCATCTTCTAAAAAAAAGATCAAAGTTGAAGAAGATGATACGATTGAATAAGAA
CAAAAATTAGCTTCTATTTATAAATAAGAAAGACTTTCTTCAATACAGTTTAGTCCTAAA
GAAGATTAATCCAAGTAGAATTAAATGGAAGTGCAAGATGATGAATAAGTAGCTATGGTT
TCTTAATTTGATAGCCGTTAAGATGCTTTTTCAAATAACAGTAAAAAAAGTGAATGTAGT
AAGGGATCAAAATCAGAGGGGAAGGCTAACAGATAACTTTAAATTAATGATTTTAGGTAG
TTTAATTCTACTTTAAAAAATAATTAAAGTAAATTATGCTAAAAAAATTTAAGCGAAGCT
GATATTTAAAATAACAATAAAATGATTGTTGAATATGAAGAATGCAATAGAACAATGGAA
TGTGAAACTAATATAAATTAGATTATAATTCATAATTAAATTGAAGAAAATAATGAAAAA
GGCTTTTAAAAAAATAATAATTAGATTGAATAAAGTAAATAAAACAGCATAAATAAAGAT
AATTAGATTTTAACTAATAATTCAACTCAATAAAGCAAGGAAAGTAAACTAAACCATAAT
ATTTAGATTTTAATAAATAATTCAATAGAAGATAACAAATAAATAAGTGCTTAAAATGAA
AATAAAAATTGCTAAATTTAAGAAGAATAGCAACCTAAAATAAATTAAAAGAAAAAAATG
AAGAATTTATTATCTTTTTGTGTTCCTACTCAAGGTAAAAATAGTGATAAGGCAAAGTAA
AAAGAAAATATTATAAATGGTGATTAAGAAAAAGATTAATTTAAGGAAAGTAGACTCATC
TAAAAAAATAAAGATGATCAACCATAAGACAAATAGGTTTAGTTAAAAAATGTGCTACAA
AAATAGTCAGAAAATAAAATAAAATCCCAGAAAGAAAGCACAAACTCAAAATTAGTATTT
GGTAAACAAAATATAAATAAAGAAGCTTAAAAATAAGATGATATACCTTAAGAAAGTGAT
CAATAATTATTAGAAGAAGATATTTAAAATCTAAATTAATAACAATAAGAAAATGAAAAT
GAATTAAAAGAGTTAGAAGAAAATAAAAAAAATATTGATGCCTAAACAAAAGCAAACGAA
AAAAATGCATAAAATTTATTTAAGATATTTATTTCACATATGGAGTAAAATGTCAAAGAT
TTAAGTGATATTTAACAGAAGAACTTGAATAAAATAAAAAAATTAAAGCCTGTAACTAAA
AATTGTTATGAAAATCAAATTAAGCAATATTAACTATCTGAATAATATGATAATTTTATT
GTTTAATATGAAAAAATCCAAGAATTAAAAAACTAATTTAGTGATTACATTGAATTTATG
AAGATTCCTAAAAAGAAAAAAAATGAAATTAATAAGTAGATCAATTAGGTTTACAAATAA
TTTCCTACTAATAGAGAGGAATTCGAGAAAACTATGAAATAAAATTTAGATATGTACTAT
TCAAGATTTTTAAAATTTACATCGTTTCCTGAGAATGAACAAAACAATAAATAAAAAAGA
GAAGAAAAATAAGAAGTTTAAAAAATGGAAATGAAAGGAAAGGATAATTATAGGGTGATA
AGTTATAAAACATAGTGGGATTAATAAATAGAAATTCGTCCTACAGAAGAATAATTAGAT
GTTATTGTTAGTGATATTAAGAAAGATACAAAAATTATTGCGTGTGCCGGTAGTGGCAAG
ACAACAACTTTAGTTATAAGACTGAAATACTTATTAGATCATGGGGTCAAACCAAATTAA
ATTATTATCAGTACTTTTAATATAGAAGCTGGTAAACATATAAGTTAGAAAGTGTATGAA
ATGATTGGAAAGGAAGTTTAGCAATCGATCCTAATTGGAAATATTGATAAAATAGCATAT
AAATTTATCAGAAGCGAGCTAGAAGCTAAGTAAAAGAATTCTCAATCAGTTTTATTATTT
AGTTAAAGAGAATATTGTGATATTTGGTTAGCACATATCAAGAAATATAAGTTTTAATAC
CTTTAATACAAATATTTTTTCTTTGACGAATTTTAAGACGTATCTGAACTACAATATGAA
ATACTCATGGAATTCAAAAAACTTAATTGCATTTTAACTGTCATAGGTGATGATGCTTAA
AATATTTACGGTTTCAGAGATACAAAAATTGATATTATTTAAAATAGAATTAATGATGAT
TTGAAGAAGAAAAAAAAGGACTTACTAGAGTTTAGATTAACTGCAAATTATAGAAGTACA
CATCTAATAACAAAATTTGCTAACAAAATTATAGAAAAAAATGAAAATTTGATTAAAAAA
ACTATGTAGAGTGCTTAGGAGATACACGGAGAAACAGAAGAAGAAAAAATGAAGAGTAAG
TATGATAAAGAAGGAGACTATCCTTACTTACATATTTTTGATTCTGAGAAATAATAAAAT
GAATCTATTATCAAAAGAATACTTTCGTTAGTTAAAAATAAAGGATTTCAATTTAAAGAT
ATTGCAATTATAGGTCCAATGAATGACTAGCTGAAAAAGTTTGAAGAAGTTGTTGAAAAG
CACAATTAAAAGAGTATTTAGAGTGACCAAATACCTTATTAAGCTTTTATCACTTTAAAA
TTTGAAGATTTTAAGTTAATAGAGTTTAATGCTGCTCCATAAAAGTAAAACAAACTCACT
ATTTCAACAATTCATAGGAGCAAGGGACTCGAGTGGGACATAGTTTACTTTTTGGGTTGT
AATGATGATTAATTTCCTATGGCTTTCGTTTAAAAAAATAAAAATTAGGCTTGTACCATT
TTAGAAGAGTAAAGAAGATTATTTTATGTTGGTGCTACAAGGGCAATAAAGGAGCTAAAC
TTTTGTTGCATTGTTAAAGAACCTGAAAAAATGAAGGAAAAAGATAAAATGTAAGGAAAA
TTTAAGGTTACCAGGTTTTTTGCAGATATTCCAAGAGAATACTATAGAGCAGATATCATT
TTAGACTTTTAAGACCACATAATAAAAGATTATAAATGGATAGAATTTGATGAATCATAA
AATGGGGAAGAGGAATAAAATTGTATTAAGATCAGAGAAGTTATATCTAAAATGAATAGC
AAGCAACTTGAAGATATAAATACTTTCACTTAAAATATAGTACAAGAAAAGGTAGTTAAA
AGCCTTTATATGGAAAAGCATGAAATTTCTCAATAAGTTAAAGACAATTAATTATTTTCA
GAAATGGGTATGTTTTTTGATAGATGTATAGTAAGAATGATTGGAGAAAAGTACAAAGCT
AAAAATTCATTCTATAATTAAGTTGCTGCTTAGGTCATATTACCTTAAATATATGAATTG
CATTTACCAGAGAATTTGTTTAGACTTTTCTTGAGGTACAGCAAGTTTTTTACAACTTTT
GACTCTGCTTAGTTAGATGATTAGAGAAATGTCATTGAAAGATTCAAAAATGAAGGTGAT
AGAGATAAGAGTGAGTAAGATATTTAAGATATGTAGGAACTTCACAATATTTTATCATAC
AATGCAGAAATTTAGTGTCTAAAAAAAATACATATTTTTAATTTTTAAAAGCACAGACCA
AACAAATATTTTTAAGATCAATTTGAAAGACTTGGATAGAGTTATATTATAGCACTTAGT
GAGTATATGAATAAACATAAAAAAAGTGAAGATATTTTTGAGAACATTTATAAAATATCA
AAATGTGGATTTTTGTTTGAGAATAGAAGAAAATACCTGTACAACAACAACTTGACTGCT
ATTTTAGATTACGAGCTCCTTAAAAACATTTAGATTAACTTTATTAACGGTTATTTATCT
TAATATTAAAGTATAGAATGCAAGAAGATTTACAAGACTAAGAATATTTAAGGTCTCATT
GATTTAATAGCAAATTAAAATCATTTAATTTTCTTTAAGTTTGATATATTCGAAACATAC
AAAAAAGAAGATTTCTTAAATTATCTTTTTGCTGCTTCTTATATGTATGTTACTGATAAA
ATTAATATAGAATAAATTAGTATATTTAATTTTCTATCTGGGACAATTCAATCAATAGAT
TTAAGAGGCTGGGATTAACAACAGTCTTTTTTCAATTAAATTGAATAAATCGCAAAAGGC
TAAATACTACAGAATGTTCAAAATAACATCTTGCAAATAATAGACTAAGAAGAAGATAAG
GTGTTAAATAAAGAACAAAAAGAAGAATTGAAAAAAATAATATTTTAAAGTAAGACTCCA
TAAGAGCTTTAAGAAAATATTGAAAATATAAAATCAGGTTAAAAATCAGTTAATAAAGCT
TAAATGATTGATGAAGGGAATAAAGGTGAAGAATAAATTGAGTAATAAAGAGATAATAAA
GATAATTAAAATTAATTAGATAGAGGTATGATAGTTGAAGAAGATTATCATTTAAAACCT
TAAGAATAAAAAGATAAAAGTTAATTAATAGATTAAAATTTCATTGAGCATAATAGATAA
GTAATTGATTCTTATGATCCTTTGAGGAAAAAAATATAGTTTGAGGAATAGAATCATCCT
GCTATTTTATTTAATGATATATAAATCGATGAAAATAGTAATTTTTTAAATAATGAATTT
GATAATATAGAAAATCAAAAGAATTTTAGTTAAATAATCAACAATAATAAAATAAATGAA
GATCACTCAAAAATGATTACTGAATAATAATAGGATTTATAATTTAAATAAGAAGAAGAA
TAAGATAAAATAAATCAAATTTAAGTTACAAATGTTTAAAATTAAAATAATGATATTAAA
ATATAAAATATTTAAAAACAACAATTTAATTAGAAAAAAACAGAATTTAAAAGTTCCATA
TAGTATCAGAAAGAGCTAAGATAAAAAGAGTTAATAGAAAGTGATAAAAGTGAGAAAGTT
TTAAATAAAATCCAAAATCTTTAACAAACATACCTTAATATATTGTAAGACACTTCAAGT
GAAACAGTAAGAGAAAAAAAGTGCTCATTTCTTACTAAAGAGAATAGTAAAAATTAAGTT
TAATTTTAACCTTAACAGATTTAAGAGAGGAAAAAGTAATTCTACTCTTCGAATAATAAT
CTAAGCAAATAATTTAATTAAAAATCATTTGAACAAAATACTCTTGAGAACTAAATTTTT
GAGGAGAGCTATTAAGCAGAACAAGATTTTGATTATTAAAAATAGCAGAAGAGTGGAAGC
ATTCCTGATTTAGAAGAAGATGATATTTCTAATATTTAATCCTAAGAAGAAGATAATAAT
TATAGTTAAAATTATAATTTTTAAAATCAGATTAAAGAAAATAAAATTATATCTTCTAAT
TTATATAAGAAAAATGTATTTAAAGGATCTAATAAAAGCCCAAATAGCAAATTAAATTTA
AAATAAGAGATAAAACTAAAACCAGGAAACATAACTCCAACTTACAAAGTGAATTAAAAA
TAGTTTGAAAAAAATAGCCTAATAAATTATAATTAGAAATTCAACTCATAGGAAGAAGAA
GACATAGATTCAGATTAAGATGATTCTGATGTTTTAAGAATTATATAAAGATTAAAAATT
TAAGAATAGGAAAAGAAAAAGCATTGA


>TTHERM_00723610(protein)
MKQTKIKQVQGQASLKSFFKPKNADVQDDIQTENKENTIYQQNLKIDIKVEDDGFYQQQI
DNNLNSVQNPSFEQNDAQEYENSYDILQKREEYIKKKLSPFKYSKKKSFKSKVKAKIGQD
DSCSSPLNKKRMKQSSKWIRMTPSSKKKIKVEEDDTIEQEQKLASIYKQERLSSIQFSPK
EDQSKQNQMEVQDDEQVAMVSQFDSRQDAFSNNSKKSECSKGSKSEGKANRQLQINDFRQ
FNSTLKNNQSKLCQKNLSEADIQNNNKMIVEYEECNRTMECETNINQIIIHNQIEENNEK
GFQKNNNQIEQSKQNSINKDNQILTNNSTQQSKESKLNHNIQILINNSIEDNKQISAQNE
NKNCQIQEEQQPKINQKKKMKNLLSFCVPTQGKNSDKAKQKENIINGDQEKDQFKESRLI
QKNKDDQPQDKQVQLKNVLQKQSENKIKSQKESTNSKLVFGKQNINKEAQKQDDIPQESD
QQLLEEDIQNLNQQQQENENELKELEENKKNIDAQTKANEKNAQNLFKIFISHMEQNVKD
LSDIQQKNLNKIKKLKPVTKNCYENQIKQYQLSEQYDNFIVQYEKIQELKNQFSDYIEFM
KIPKKKKNEINKQINQVYKQFPTNREEFEKTMKQNLDMYYSRFLKFTSFPENEQNNKQKR
EEKQEVQKMEMKGKDNYRVISYKTQWDQQIEIRPTEEQLDVIVSDIKKDTKIIACAGSGK
TTTLVIRLKYLLDHGVKPNQIIISTFNIEAGKHISQKVYEMIGKEVQQSILIGNIDKIAY
KFIRSELEAKQKNSQSVLLFSQREYCDIWLAHIKKYKFQYLQYKYFFFDEFQDVSELQYE
ILMEFKKLNCILTVIGDDAQNIYGFRDTKIDIIQNRINDDLKKKKKDLLEFRLTANYRST
HLITKFANKIIEKNENLIKKTMQSAQEIHGETEEEKMKSKYDKEGDYPYLHIFDSEKQQN
ESIIKRILSLVKNKGFQFKDIAIIGPMNDQLKKFEEVVEKHNQKSIQSDQIPYQAFITLK
FEDFKLIEFNAAPQKQNKLTISTIHRSKGLEWDIVYFLGCNDDQFPMAFVQKNKNQACTI
LEEQRRLFYVGATRAIKELNFCCIVKEPEKMKEKDKMQGKFKVTRFFADIPREYYRADII
LDFQDHIIKDYKWIEFDESQNGEEEQNCIKIREVISKMNSKQLEDINTFTQNIVQEKVVK
SLYMEKHEISQQVKDNQLFSEMGMFFDRCIVRMIGEKYKAKNSFYNQVAAQVILPQIYEL
HLPENLFRLFLRYSKFFTTFDSAQLDDQRNVIERFKNEGDRDKSEQDIQDMQELHNILSY
NAEIQCLKKIHIFNFQKHRPNKYFQDQFERLGQSYIIALSEYMNKHKKSEDIFENIYKIS
KCGFLFENRRKYLYNNNLTAILDYELLKNIQINFINGYLSQYQSIECKKIYKTKNIQGLI
DLIANQNHLIFFKFDIFETYKKEDFLNYLFAASYMYVTDKINIEQISIFNFLSGTIQSID
LRGWDQQQSFFNQIEQIAKGQILQNVQNNILQIIDQEEDKVLNKEQKEELKKIIFQSKTP
QELQENIENIKSGQKSVNKAQMIDEGNKGEEQIEQQRDNKDNQNQLDRGMIVEEDYHLKP
QEQKDKSQLIDQNFIEHNRQVIDSYDPLRKKIQFEEQNHPAILFNDIQIDENSNFLNNEF
DNIENQKNFSQIINNNKINEDHSKMITEQQQDLQFKQEEEQDKINQIQVTNVQNQNNDIK
IQNIQKQQFNQKKTEFKSSIQYQKELRQKELIESDKSEKVLNKIQNLQQTYLNILQDTSS
ETVREKKCSFLTKENSKNQVQFQPQQIQERKKQFYSSNNNLSKQFNQKSFEQNTLENQIF
EESYQAEQDFDYQKQQKSGSIPDLEEDDISNIQSQEEDNNYSQNYNFQNQIKENKIISSN
LYKKNVFKGSNKSPNSKLNLKQEIKLKPGNITPTYKVNQKQFEKNSLINYNQKFNSQEEE
DIDSDQDDSDVLRIIQRLKIQEQEKKKH


>TTHERM_00723610(gene)
ATGAAATAAACTAAAATAAAATAAGTTTAAGGTTAGGCTTCATTAAAAAGTTTTTTTAAA
CCTAAAAACGCAGATGTTTAGGATGATATTTAGACTGAAAATAAAGAAAATACAATCTAT
TAATAGAATTTAAAAATAGATATCAAAGTGGAAGATGATGGATTCTATCAGCAATAAATT
GATAACAATTTAAATTCTGTATAAAATCCTAGTTTTGAATAAAATGATGCTTAGGAATAC
GAAAATAGTTATGATATTTTACAAAAAAGGGAGGAATACATCAAAAAAAAATTAAGTCCT
TTCAAATACAGTAAAAAAAAATCATTCAAATCAAAAGTTAAAGCTAAAATAGGGTAAGAT
GATAGTTGTTCATCTCCTCTCAATAAAAAAAGAATGAAATAATCATCAAAATGGATTAGA
ATGACACCATCTTCTAAAAAAAAGATCAAAGTTGAAGAAGATGATACGATTGAATAAGAA
CAAAAATTAGCTTCTATTTATAAATAAGAAAGACTTTCTTCAATACAGTTTAGTCCTAAA
GAAGATTAATCCAAGTAGAATTAAATGGAAGTGCAAGATGATGAATAAGTAGCTATGGTT
TCTTAATTTGATAGCCGTTAAGATGCTTTTTCAAATAACAGTAAAAAAAGTGAATGTAGT
AAGGGATCAAAATCAGAGGGGAAGGCTAACAGATAACTTTAAATTAATGATTTTAGGTAG
TTTAATTCTACTTTAAAAAATAATTAAAGTAAATTATGCTAAAAAAATTTAAGCGAAGCT
GATATTTAAAATAACAATAAAATGATTGTTGAATATGAAGAATGCAATAGAACAATGGAA
TGTGAAACTAATATAAATTAGATTATAATTCATAATTAAATTGAAGAAAATAATGAAAAA
GGCTTTTAAAAAAATAATAATTAGATTGAATAAAGTAAATAAAACAGCATAAATAAAGAT
AATTAGATTTTAACTAATAATTCAACTCAATAAAGCAAGGAAAGTAAACTAAACCATAAT
ATTTAGATTTTAATAAATAATTCAATAGAAGATAACAAATAAATAAGTGCTTAAAATGAA
AATAAAAATTGCTAAATTTAAGAAGAATAGCAACCTAAAATAAATTAAAAGAAAAAAATG
AAGAATTTATTATCTTTTTGTGTTCCTACTCAAGGTAAAAATAGTGATAAGGCAAAGTAA
AAAGAAAATATTATAAATGGTGATTAAGAAAAAGATTAATTTAAGGAAAGTAGACTCATC
TAAAAAAATAAAGATGATCAACCATAAGACAAATAGGTTTAGTTAAAAAATGTGCTACAA
AAATAGTCAGAAAATAAAATAAAATCCCAGAAAGAAAGCACAAACTCAAAATTAGTATTT
GGTAAACAAAATATAAATAAAGAAGCTTAAAAATAAGATGATATACCTTAAGAAAGTGAT
CAATAATTATTAGAAGAAGATATTTAAAATCTAAATTAATAACAATAAGAAAATGAAAAT
GAATTAAAAGAGTTAGAAGAAAATAAAAAAAATATTGATGCCTAAACAAAAGCAAACGAA
AAAAATGCATAAAATTTATTTAAGATATTTATTTCACATATGGAGTAAAATGTCAAAGAT
TTAAGTGATATTTAACAGAAGAACTTGAATAAAATAAAAAAATTAAAGCCTGTAACTAAA
AATTGTTATGAAAATCAAATTAAGCAATATTAACTATCTGAATAATATGATAATTTTATT
GTTTAATATGAAAAAATCCAAGAATTAAAAAACTAATTTAGTGATTACATTGAATTTATG
AAGATTCCTAAAAAGAAAAAAAATGAAATTAATAAGTAGATCAATTAGGTTTACAAATAA
TTTCCTACTAATAGAGAGGAATTCGAGAAAACTATGAAATAAAATTTAGATATGTACTAT
TCAAGATTTTTAAAATTTACATCGTTTCCTGAGAATGAACAAAACAATAAATAAAAAAGA
GAAGAAAAATAAGAAGTTTAAAAAATGGGTATTTATTAATTTTAATGAGAATAAGCGATA
GAGTTAATAATTTATTTTTTATTTATAGAAATGAAAGGAAAGGATAATTATAGGGTGATA
AGTTATAAAACATAGTGGGATTAATAAATAGAAATTCGTCCTACAGAAGAATAATTAGAT
GTTATTGTTAGTGATATTAAGAAAGATACAAAAATTATTGCGTGTGCCGGTAAATATTAT
GCATAAAAATATTTTATAAAATTTATTATCAAACAGGTAGTGGCAAGACAACAACTTTAG
TTATAAGACTGAAATACTTATTAGATCATGGGGTCAAACCAAATTAAATTATTATCAGTA
CTTTTAATATAGAAGCTGGTAAACATATAAGTTAGAAAGTGTATGAAATGATTGGAAAGG
AAGTTTAGCAATCGATCCTAATTGGAAATATTGATAAAATAGCATATAAATTTATCAGAA
GCGAGCTAGAAGCTAAGTAAAAGAATTCTCAATCAGTTTTATTATTTAGTTAAAGAGAAT
ATTGTGATATTTGGTTAGCACATATCAAGAAATATAAGTTTTAATACCTTTAATACAAAT
ATTTTTTCTTTGACGAATTTTAAGACGTATCTGAACTACAATATGAAATACTCATGGAAT
TCAAAAAACTTAATTGCATTTTAACTGTCATAGGTAATAATTTCTTATTTTATATATTTA
ATGTGATACTTTACTTAGCATTAAAATCTAATCTTTTCTTGAATCAAATTTTAGAAACCT
AATAAATAATTTTTTAAAATTTGGTTTTTCAAAATTTTGGATAAAATAAGTTGAGAAAAA
TGTGGTGGACTAAATTATTTGAAATTTCATATTTAAAATTTAAAGATATAGCTGATCTTT
TTTTACTTAGTTTAGTAGTTGATAATAAGACTTAATAATTTAATTGAAAAGATAATTAGC
ACAAAAAATAATTATATATTTTAAATATATATATTCTTATTTAAATTAGGTGATGATGCT
TAAAATATTTACGGTTTCAGAGATACAAAAATTGATATTATTTAAAATAGAATTAATGAT
GATTTGAAGAAGAAAAAAAAGGACTTACTAGAGTTTAGATTAACTGCAAATTATAGAAGT
ACACATCTAATAACAAAATTTGCTAACAAAATTATAGAAAAAAATGAAAATTTGATTAAA
AAAACTATGTAGAGTGCTTAGGAGATACACGGAGAAACAGAAGAAGAAAAAATGAAGAGT
AAGTATGATAAAGAAGGAGACTATCCTTACTTACATATTTTTGATTCTGAGAAATAATAA
AATGAATCTATTATCAAAAGAATACTTTCGTTAGTTAAAAATAAAGGATTTCAATTTAAA
GATATTGCAATTATAGGTCCAATGAATGACTAGCTGAAAAAGTTTGAAGAAGTTGTTGAA
AAGCACAATTAAAAGAGTATTTAGAGTGACCAAATACCTTATTAAGCTTTTATCACTTTA
AAATTTGAAGATTTTAAGTTAATAGAGTTTAATGCTGCTCCATAAAAGTAAAACAAACTC
ACTATTTCAACAATTCATAGGAGCAAGGGACTCGAGTGGGACATAGTTTACTTTTTGGGT
TGTAATGATGATTAATTTCCTATGGCTTTCGTTTAAAAAAATAAAAATTAGGCTTGTACC
ATTTTAGAAGAGTAAAGAAGATTATTTTATGTTGGTGCTACAAGGGCAATAAAGGAGCTA
AACTTTTGTTGCATTGTTAAAGAACCTGAAAAAATGAAGGAAAAAGATAAAATGTAAGGA
AAATTTAAGGTTACCAGGTTTTTTGCAGATATTCCAAGAGAATACTATAGAGCAGATATC
ATTTTAGACTTTTAAGACCACATAATAAAAGATTATAAATGGATAGAATTTGATGAATCA
TAAAATGGGGAAGAGGAATAAAATTGTATTAAGATCAGAGAAGTTATATCTAAAATGAAT
AGCAAGCAACTTGAAGATATAAATACTTTCACTTAAAATATAGTACAAGAAAAGGTAGTT
AAAAGCCTTTATATGGAAAAGCATGAAATTTCTCAATAAGTTAAAGACAATTAATTATTT
TCAGAAATGGGTATGTTTTTTGATAGATGTATAGTAAGAATGATTGGAGAAAAGTACAAA
GCTAAAAATTCATTCTATAATTAAGTAAAATTTTAATTTACCTTATTTAATAATTCATAT
TATAATATAAAGTTGCTAATAATAAAAATTCAAGTAAAAGCATAACAAAATAATCTATAT
TTATTACTTAATATAAATTCATTTTGATTGAAAAAAAAAGAGGAATTTTTTATTATTAAA
TTTATTTCACAATAAAATTAATAAAAAAAAAATTTAAGCCAATAAATTAATTAATAAATT
AAATAGGTTGCTGCTTAGGTCATATTACCTTAAATATATGAATTGCATTTACCAGAGAAT
TTGTTTAGACTTTTCTTGAGGTACAGCAAGTTTTTTACAACTTTTGACTCTGCTTAGTTA
GATGATTAGAGAAATGTCATTGAAAGATTCAAAAATGAAGGTGATAGAGATAAGAGTGAG
TAAGATATTTAAGATATGTAGGAACTTCACAATATTTTATCATACAATGCAGAAATTTAG
TGTCTAAAAAAAATACATATTTTTAATTTTTAAAAGCACAGACCAAACAAATATTTTTAA
GATCAATTTGAAAGACTTGGATAGAGTTATATTATAGCACTTAGTGAGTATATGAATAAA
CATAAAAAAAGTGAAGATATTTTTGAGAACATTTATAAAATATCAAAATGTGGATTTTTG
TTTGAGAATAGAAGAAAATACCTGTACAACAACAACTTGACTGCTATTTTAGATTACGAG
CTCCTTAAAAACATTTAGATTAACTTTATTAACGGTTATTTATCTTAATATTAAAGTATA
GAATGCAAGAAGATTTACAAGACTAAGAATATTTAAGGTCTCATTGATTTAATAGCAAAT
TAAAATCATTTAATTTTCTTTAAGTTTGATATATTCGAAACATACAAAAAAGAAGATTTC
TTAAATTATCTTTTTGCTGCTTCTTATATGTATGTTACTGATAAAATTAATATAGAATAA
ATTAGTATATTTAATTTTCTATCTGGGACAATTCAATCAATAGATTTAAGAGGCTGGGAT
TAACAACAGTCTTTTTTCAATTAAATTGAATAAATCGCAAAAGGCTAAATACTACAGAAT
GTTCAAAATAACATCTTGCAAATAATAGACTAAGAAGAAGATAAGGTGTTAAATAAAGAA
CAAAAAGAAGAATTGAAAAAAATAATATTTTAAAGTAAGACTCCATAAGAGCTTTAAGAA
AATATTGAAAATATAAAATCAGGTTAAAAATCAGTTAATAAAGCTTAAATGATTGATGAA
GGGAATAAAGGTGAAGAATAAATTGAGTAATAAAGAGATAATAAAGATAATTAAAATTAA
TTAGATAGAGGTATGATAGTTGAAGAAGATTATCATTTAAAACCTTAAGAATAAAAAGAT
AAAAGTTAATTAATAGATTAAAATTTCATTGAGCATAATAGATAAGTAATTGATTCTTAT
GATCCTTTGAGGAAAAAAATATAGTTTGAGGAATAGAATCATCCTGCTATTTTATTTAAT
GATATATAAATCGATGAAAATAGTAATTTTTTAAATAATGAATTTGATAATATAGAAAAT
CAAAAGAATTTTAGTTAAATAATCAACAATAATAAAATAAATGAAGATCACTCAAAAATG
ATTACTGAATAATAATAGGATTTATAATTTAAATAAGAAGAAGAATAAGATAAAATAAAT
CAAATTTAAGTTACAAATGTTTAAAATTAAAATAATGATATTAAAATATAAAATATTTAA
AAACAACAATTTAATTAGAAAAAAACAGAATTTAAAAGTTCCATATAGTATCAGAAAGAG
CTAAGATAAAAAGAGTTAATAGAAAGTGATAAAAGTGAGAAAGTTTTAAATAAAATCCAA
AATCTTTAACAAACATACCTTAATATATTGTAAGACACTTCAAGTGAAACAGTAAGAGAA
AAAAAGTGCTCATTTCTTACTAAAGAGAATAGTAAAAATTAAGTTTAATTTTAACCTTAA
CAGATTTAAGAGAGGAAAAAGTAATTCTACTCTTCGAATAATAATCTAAGCAAATAATTT
AATTAAAAATCATTTGAACAAAATACTCTTGAGAACTAAATTTTTGAGGAGAGCTATTAA
GCAGAACAAGATTTTGATTATTAAAAATAGCAGAAGAGTGGAAGCATTCCTGATTTAGAA
GAAGATGATATTTCTAATATTTAATCCTAAGAAGAAGATAATAATTATAGTTAAAATTAT
AATTTTTAAAATCAGATTAAAGAAAATAAAATTATATCTTCTAATTTATATAAGAAAAAT
GTATTTAAAGGATCTAATAAAAGCCCAAATAGCAAATTAAATTTAAAATAAGAGATAAAA
CTAAAACCAGGAAACATAACTCCAACTTACAAAGTGAATTAAAAATAGTTTGAAAAAAAT
AGCCTAATAAATTATAATTAGAAATTCAACTCATAGGAAGAAGAAGACATAGATTCAGAT
TAAGATGATTCTGATGTTTTAAGAATTATATAAAGATTAAAAATTTAAGAATAGGAAAAG
AAAAAGCATTGA