Identifiers and Description

Gene Model Identifier

TTHERM_00730300

Standard Name

UDH1 (UvrD/REP-family DNA helicase 1)

Aliases

PreTt02749 | 119.m00074

Description

UvrD/REP helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00580 ) UvrD/REP helicase
  • ( TIGR01075 ) DNA helicase II
  • ( TIGR01074 ) ATP-dependent DNA helicase Rep
  • ( TIGR01784 ) conserved hypothetical protein
  • ( TIGR01073 ) ATP-dependent DNA helicase PcrA
  • ( PF08820 ) Domain of unknown function (DUF1803)
  • ( PF05970 ) Eukaryotic protein of unknown function

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00730300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19668.13.998306063536528e-116UvrD/REP helicase (1047 aa)
OxytrichaContig4754.0.g70.0000000039998859049333245UvrD/REP helicase N-terminal d
omain
SGDYOL095C0.0000007001298633766835HMI1 Mitochondrial inner membr
ane localized ATP-dependent DN
A helicase, required for the m
aintenance of the mitochondria
l genome; not required for mit
ochondrial transcription; has
homology to E. coli helicase u
vrD

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00730300(coding)
ATGTCTAACAAAAACGATTTCAACGATTGCGAACTTAGTGAAGAGTAGAAGAAAATAGTC
TATTCAGATATTAATCAAAACTAAAAAATTGAAGCTTGTGCAGGTTCTGGTAAGACAACT
ACTCTCATTTATAGGGTTAAATATTTGATCAATAACAAAATAAAGCCATAAAAAATAATA
TTAACCACTTTCAATATAGAAGCAGCTAAAAATTTAAATAAAAAAGCCAAATAGGTTCTA
GAAACTAAAGATTAAACAAATTTGAAAATAGTTAATATTGATAAATTCATTTATGAAATA
TATGAATCAAATCTAAAAATAAATGATCCCCTTTAAAAAAAATACATAAAGCAAAGCTTA
ACATATATTAGTAGCTTAGTCTTAAAATATTTATCTTCTGATTAAGGAAGAAAAATTTTG
AATTAATATAGTCATTTCTTTTTTGATGAATTTTAAGATATAAATGATATATAATATAAT
ATTCTAATGTAATTTTGCAAGAATAATTGCAAAATAATAGCAATAGGGGATGAAGCTTAG
AATATTTATAGCTTTAGAAACTCAAGATTAGAGTTTATTTAGAAAAAAATAGATGATGAT
GTAGAGAAATACTAAAATTAAAAAATACATATCTACAACCTTTCAATAAATTTTAGAAGT
TAAAGTAAGATAATAGAGTTCTGTAACTAAATCCTAATTAATATCAAAAAATCTCATCAA
ATGTAAAGTGCAAAATAGAGTTATTAAGAAGAAGAAAAACCTATAGTAAAAATATATTAA
AGCAAATAAGAGTAGTATGAAACTATTATAGAAGAAATATATGATTTAGTTTAAAAACAT
AAATACTAACTGAGTGATATAGCTATTTTAAGTCCAAGAAATGAAGAAATAAAACATATT
TAAGCTATTTTAGAGAGAAAAAATTATGAAGTAAGAAAAAATAGTTAAAATTAAACCATT
ATTCAATAAGAACAATAATAAGAGGAAATTCCATATAGAATACTTTAAAAAAATTCTAAC
TTATTACTACTTAACTATTCAAAGACATTTGATGATGATGATATTATTGCTAAATTAACA
TTAAGTACATTTCATTCTTCTAAGGGTCTGGAGTGGAAAGTAGTTTATATAGTAGGAATA
AATGATAAACACTTTCCAAGAGCATTCTTAGCGTAATCAAATTAAGAAAATACTAAAGAA
AAATTAATTGAAATTCTGAGAACTTTTTATGTAGCTTGTACGAGGTCCATAGATTTATTG
AATCTTTCATTTGTAAAAGATGATAATAAAGTTGAATTTATTTGTAGATTTATGAGTTAA
ATAAACGAAAAATATTTTTAAAAGGATGAATATTTCAAAAAGAAAAATATTGCTAAGATG
AATTTGCAAAGCTATAATTAACAGTTAATTAAATAAGGTGAAAATGAATTTTAATAAAAT
TTAAGTAAAACTAATCATAAAGAGAGTTCTTTATTTTAAATCATATCCAATTTCTCATTT
AATGACTTTGAGAAGATTAATTAATATCTTCAAGATTTAGAATAACTTGAACTAAATATA
AATTAAACGAAAAAAAAAGTAACTTACTCTTTAAAAGATTTAAAACCAAACAATAATTGC
TAGAGTCTTTTATCTTATCTTGATTTATTATTACAAAGAACTATAGCTGAAAAATTTAAT
TTAAATTCAGGATATCGCTATTAAAAAGCAGAAAAAATACTTTTTTGCATTGATTTAGAT
AAAAAACAACAAGCTATCTTTAATGAATTTAAGTGCTTATTTAGTGAATATTGTGAAAAA
ACTAACAATTATTAATAATTTTTAGAAATACTGTTAACATAATATTAAAGAGATTCAAAT
AGAATATAAAAAATTAACAACTCAAAATAAGAGATATGTTCTATTTATGAAACAATTAAA
TCATATTTGAAAGATTATAAAATAAAATTTAAAGACATTTAACATCATACCAAAAAATAT
TTTCCTGATAATTTCCAACATAAATAATAATTTTATGAATGCTATAAAAAGTTTATAAAT
AAAGAACACAAATTTCTTTCATACCTTAATCCACCAAATTAAAAATAGCAAATTAGTAAA
ACTTAATTTATATACGTATTAAGTAAATTAGATTTAATATACGAAGGAAAGCAAGAATGT
TTGTATAGGAATGATAGTGAGGACATAGATATCTATCATAAATTTACATTGAAATATAAT
ATAGAAAGATTTCTAAAAATAATTGAATCAAAAACAAAAGATAATAAAGATTTTAACATA
GAAGTCAAGAAAGAGGTAAAGGATTAAGGATAGTTGTATGGAATTGTTGATTTACTTGTT
GGTGATACTATTTATAAATTTGTTTATAATTTTTAAGAAGTTTACCCTATATAAATAGCA
CACTAAGATATTATTTAGTAGCTAGCATTTGCTTTAATTTTGAATGAGTAAGGAGCTAAA
ATAACATAAATAAGCTTCTATAATATTATCGAAGAAGATAAGATAGATTATTCAATTCAA
AAATTTATTGAAAATCCAGTCATATCAAAGGATTATTTAGAGTTCTTAAAATACAAAGCA
AGTAGTTTAGAATAAGAATTTGTATAAACATCATATGGTGAGTAATAAATAGAGCAACAA
TAAATGCCTAATCTTAATTTAGCAAATGAGATCAATAATTACTAACTTTAGAGTAATTAA
AATTAAAGTTAACAAATTTTATAGTTTTAAGAATAATTTGATAGCAATAAGGATTCTTTA
AAAGAAATACAATAAGATAAAAGCCCGTTTTAAATCAAAGAATAATAAAAAAATGAAATA
CATCAATTAAATTAATTCTAATATACTAACTATTAAGATTTGAACTAAAAATCTTTTGAT
GATATTTGTATCCAAAATTAGTTTTACTCATATTAAGATAATACTTTTCAAAAGGAATCA
AAATAAAAATCATTTGATGATTAAATGTTAAAAAAGAATCAGTAAATTAATTTATTTGAA
ACTAAATATATGAATTAAAATGTTTCATTAAATAACTATGATTATAATATAGAGTAAAAT
TAAATTTAATAACAACATCAAAATTAATAAGACCAAAAACGATATCCATTCTAATTTATC
AATGAGGGGTCATAATTAGAAGAAGATTAAAAACTTAACAAATTTCATTTCTAATTTTAA
AATGAGTAGAATATGTTAAATAATTAAAATTAAACAGTAAATAATAAACTTTTGATTGAA
AATTAAAATTAATTATTTATTAAATAAGCTAAATAAAACTAATTATTTTAAAGTGATACT
TAAAATGAAGAGGAAAAGATAATAGATAAATTTTAAGAACCAATACCATATACTAACTAT
TATTGCAAGGAAAGTATGAATAATTAAATAAAATTAATAACTTAGACAAACTCTAATAAT
TTTGGAAATATACCTAAATTTTAAAATTAACAATCTTTATTTGAAGAAAGCGACTTCATT
TAAAATTAATAAAAATAGATTATTTCTAAAGTCACTGACAATAATCCTAAAAGTGATTTA
AATTAAAATTTTCCTTAATAAGCAGGATAATTTTTAAAAACTAATGTGTTAGAGAATATT
CCATAAAATACTTTGGATAATAAGCAATTAGATTAAATAGAGAATAGTAATTTATATTAA
AAATCAAATAATTTACATTTATTAGCACATTAATAAGTAAATTAGGATAAAATAATAAAA
GAAATTTAAGAATAGTTAAGTAAACTGAATCAATTAGTAATTAATAACACTAAGAACATA
ATAGAAATATTATAATGGTTGTCATAAGATATAAACAATTTGAATGATAAATCAGTTAAT
GAATAAATTTAGTAATTGCAAATAAGTTTATCAAAATAATTTGTTAAAATTAATTATTAA
AAAATATAATTAATGCTGATAATGTATACTGCAAATAAAAGCTATTCAGATTTTAAAAAG
AACGAATTAATATAATTTTTAGTTGACTTAATAACGATAGAATAAAATAACAAACCAATA
AATAAAAAAAATATTAAATTTGCAAATTAAATTGATAGTTATCCAACAAGTGATGAAGAT
TTAGATTTAGATGAATAAATATTAAAAATAAAACAAGGTTTAGCTATAGAGAGCCAAATT
GAATAATGTAATGATTGGTATGAGATACGAGGAGACGTTGCTAAAATTTTAAAAAAAAGA
GATAAGCCAAATAAGAGATAATTTGAACAAACAGATGAATCAATTTAAAATGAACAATAA
GTTTACAAGTAATTAAAATAATGA


>TTHERM_00730300(protein)
MSNKNDFNDCELSEEQKKIVYSDINQNQKIEACAGSGKTTTLIYRVKYLINNKIKPQKII
LTTFNIEAAKNLNKKAKQVLETKDQTNLKIVNIDKFIYEIYESNLKINDPLQKKYIKQSL
TYISSLVLKYLSSDQGRKILNQYSHFFFDEFQDINDIQYNILMQFCKNNCKIIAIGDEAQ
NIYSFRNSRLEFIQKKIDDDVEKYQNQKIHIYNLSINFRSQSKIIEFCNQILINIKKSHQ
MQSAKQSYQEEEKPIVKIYQSKQEQYETIIEEIYDLVQKHKYQLSDIAILSPRNEEIKHI
QAILERKNYEVRKNSQNQTIIQQEQQQEEIPYRILQKNSNLLLLNYSKTFDDDDIIAKLT
LSTFHSSKGLEWKVVYIVGINDKHFPRAFLAQSNQENTKEKLIEILRTFYVACTRSIDLL
NLSFVKDDNKVEFICRFMSQINEKYFQKDEYFKKKNIAKMNLQSYNQQLIKQGENEFQQN
LSKTNHKESSLFQIISNFSFNDFEKINQYLQDLEQLELNINQTKKKVTYSLKDLKPNNNC
QSLLSYLDLLLQRTIAEKFNLNSGYRYQKAEKILFCIDLDKKQQAIFNEFKCLFSEYCEK
TNNYQQFLEILLTQYQRDSNRIQKINNSKQEICSIYETIKSYLKDYKIKFKDIQHHTKKY
FPDNFQHKQQFYECYKKFINKEHKFLSYLNPPNQKQQISKTQFIYVLSKLDLIYEGKQEC
LYRNDSEDIDIYHKFTLKYNIERFLKIIESKTKDNKDFNIEVKKEVKDQGQLYGIVDLLV
GDTIYKFVYNFQEVYPIQIAHQDIIQQLAFALILNEQGAKITQISFYNIIEEDKIDYSIQ
KFIENPVISKDYLEFLKYKASSLEQEFVQTSYGEQQIEQQQMPNLNLANEINNYQLQSNQ
NQSQQILQFQEQFDSNKDSLKEIQQDKSPFQIKEQQKNEIHQLNQFQYTNYQDLNQKSFD
DICIQNQFYSYQDNTFQKESKQKSFDDQMLKKNQQINLFETKYMNQNVSLNNYDYNIEQN
QIQQQHQNQQDQKRYPFQFINEGSQLEEDQKLNKFHFQFQNEQNMLNNQNQTVNNKLLIE
NQNQLFIKQAKQNQLFQSDTQNEEEKIIDKFQEPIPYTNYYCKESMNNQIKLITQTNSNN
FGNIPKFQNQQSLFEESDFIQNQQKQIISKVTDNNPKSDLNQNFPQQAGQFLKTNVLENI
PQNTLDNKQLDQIENSNLYQKSNNLHLLAHQQVNQDKIIKEIQEQLSKLNQLVINNTKNI
IEILQWLSQDINNLNDKSVNEQIQQLQISLSKQFVKINYQKIQLMLIMYTANKSYSDFKK
NELIQFLVDLITIEQNNKPINKKNIKFANQIDSYPTSDEDLDLDEQILKIKQGLAIESQI
EQCNDWYEIRGDVAKILKKRDKPNKRQFEQTDESIQNEQQVYKQLKQ


>TTHERM_00730300(gene)
ATGTCTAACAAAAACGATTTCAACGATTGCGAACTTAGTGAAGAGTAGAAGAAAATAGTC
TATTCAGATATTAATCAAAACTAAAAAATTGAAGCTTGTGCAGGTTCTGGTAAGACAACT
ACTCTCATTTATAGGGTTAAATATTTGATCAATAACAAAATAAAGCCATAAAAAATAATA
TTAACCACTTTCAATATAGAAGCAGCTAAAAATTTAAATAAAAAAGCCAAATAGGTTCTA
GAAACTAAAGATTAAACAAATTTGAAAATAGTTAATATTGATAAATTCATTTATGAAATA
TATGAATCAAATCTAAAAATAAATGATCCCCTTTAAAAAAAATACATAAAGCAAAGCTTA
ACATATATTAGTAGCTTAGTCTTAAAATATTTATCTTCTGATTAAGGAAGAAAAATTTTG
AATTAATATAGTCATTTCTTTTTTGATGAATTTTAAGATATAAATGATATATAATATAAT
ATTCTAATGTAATTTTGCAAGAATAATTGCAAAATAATAGCAATAGGGGATGAAGCTTAG
AATATTTATAGCTTTAGAAACTCAAGATTAGAGTTTATTTAGAAAAAAATAGATGATGAT
GTAGAGAAATACTAAAATTAAAAAATACATATCTACAACCTTTCAATAAATTTTAGAAGT
TAAAGTAAGATAATAGAGTTCTGTAACTAAATCCTAATTAATATCAAAAAATCTCATCAA
ATGTAAAGTGCAAAATAGAGTTATTAAGAAGAAGAAAAACCTATAGTAAAAATATATTAA
AGCAAATAAGAGTAGTATGAAACTATTATAGAAGAAATATATGATTTAGTTTAAAAACAT
AAATACTAACTGAGTGATATAGCTATTTTAAGTCCAAGAAATGAAGAAATAAAACATATT
TAAGCTATTTTAGAGAGAAAAAATTATGAAGTAAGAAAAAATAGTTAAAATTAAACCATT
ATTCAATAAGAACAATAATAAGAGGAAATTCCATATAGAATACTTTAAAAAAATTCTAAC
TTATTACTACTTAACTATTCAAAGACATTTGATGATGATGATATTATTGCTAAATTAACA
TTAAGTACATTTCATTCTTCTAAGGGTCTGGAGTGGAAAGTAGTTTATATAGTAGGAATA
AATGATAAACACTTTCCAAGAGCATTCTTAGCGTAATCAAATTAAGAAAATACTAAAGAA
AAATTAATTGAAATTCTGAGAACTTTTTATGTAGCTTGTACGAGGTCCATAGATTTATTG
AATCTTTCATTTGTAAAAGATGATAATAAAGTTGAATTTATTTGTAGATTTATGAGTTAA
ATAAACGAAAAATATTTTTAAAAGGATGAATATTTCAAAAAGAAAAATATTGCTAAGATG
AATTTGCAAAGCTATAATTAACAGTTAATTAAATAAGGTGAAAATGAATTTTAATAAAAT
TTAAGTAAAACTAATCATAAAGAGAGTTCTTTATTTTAAATCATATCCAATTTCTCATTT
AATGACTTTGAGAAGATTAATTAATATCTTCAAGATTTAGAATAACTTGAACTAAATATA
AATTAAACGAAAAAAAAAGTAACTTACTCTTTAAAAGATTTAAAACCAAACAATAATTGC
TAGAGTCTTTTATCTTATCTTGATTTATTATTACAAAGAACTATAGCTGAAAAATTTAAT
TTAAATTCAGGATATCGCTATTAAAAAGCAGAAAAAATACTTTTTTGCATTGATTTAGAT
AAAAAACAACAAGCTATCTTTAATGAATTTAAGTGCTTATTTAGTGAATATTGTGAAAAA
ACTAACAATTATTAATAATTTTTAGAAATACTGTTAACATAATATTAAAGAGATTCAAAT
AGAATATAAAAAATTAACAACTCAAAATAAGAGATATGTTCTATTTATGAAACAATTAAA
TCATATTTGAAAGATTATAAAATAAAATTTAAAGACATTTAACATCATACCAAAAAATAT
TTTCCTGATAATTTCCAACATAAATAATAATTTTATGAATGCTATAAAAAGTTTATAAAT
AAAGAACACAAATTTCTTTCATACCTTAATCCACCAAATTAAAAATAGCAAATTAGTAAA
ACTTAATTTATATACGTATTAAGTAAATTAGATTTAATATACGAAGGAAAGCAAGAATGT
TTGTATAGGAATGATAGTGAGGACATAGATATCTATCATAAATTTACATTGAAATATAAT
ATAGAAAGATTTCTAAAAATAATTGAATCAAAAACAAAAGATAATAAAGATTTTAACATA
GAAGTCAAGAAAGAGGTAAAGGATTAAGGATAGTTGTATGGAATTGTTGATTTACTTGTT
GGTGATACTATTTATAAATTTGTTTATAATTTTTAAGAAGTTTACCCTATATAAATAGCA
CACTAAGATATTATTTAGTAGCTAGCATTTGCTTTAATTTTGAATGAGTAAGGAGCTAAA
ATAACATAAATAAGCTTCTATAATATTATCGAAGAAGATAAGATAGATTATTCAATTCAA
AAATTTATTGAAAATCCAGTCATATCAAAGGATTATTTAGAGTTCTTAAAATACAAAGCA
AGTAGTTTAGAATAAGAATTTGTATAAACATCATATGGTGAGTAATAAATAGAGCAACAA
TAAATGCCTAATCTTAATTTAGCAAATGAGATCAATAATTACTAACTTTAGAGTAATTAA
AATTAAAGTTAACAAATTTTATAGTTTTAAGAATAATTTGATAGCAATAAGGATTCTTTA
AAAGAAATACAATAAGATAAAAGCCCGTTTTAAATCAAAGAATAATAAAAAAATGAAATA
CATCAATTAAATTAATTCTAATATACTAACTATTAAGATTTGAACTAAAAATCTTTTGAT
GATATTTGTATCCAAAATTAGTTTTACTCATATTAAGATAATACTTTTCAAAAGGAATCA
AAATAAAAATCATTTGATGATTAAATGTTAAAAAAGAATCAGTAAATTAATTTATTTGAA
ACTAAATATATGAATTAAAATGTTTCATTAAATAACTATGATTATAATATAGAGTAAAAT
TAAATTTAATAACAACATCAAAATTAATAAGACCAAAAACGATATCCATTCTAATTTATC
AATGAGGGGTCATAATTAGAAGAAGATTAAAAACTTAACAAATTTCATTTCTAATTTTAA
AATGAGTAGAATATGTTAAATAATTAAAATTAAACAGTAAATAATAAACTTTTGATTGAA
AATTAAAATTAATTATTTATTAAATAAGCTAAATAAAACTAATTATTTTAAAGTGATACT
TAAAATGAAGAGGAAAAGATAATAGATAAATTTTAAGAACCAATACCATATACTAACTAT
TATTGCAAGGAAAGTATGAATAATTAAATAAAATTAATAACTTAGACAAACTCTAATAAT
TTTGGAAATATACCTAAATTTTAAAATTAACAATCTTTATTTGAAGAAAGCGACTTCATT
TAAAATTAATAAAAATAGATTATTTCTAAAGTCACTGACAATAATCCTAAAAGTGATTTA
AATTAAAATTTTCCTTAATAAGCAGGATAATTTTTAAAAACTAATGTGTTAGAGAATATT
CCATAAAATACTTTGGATAATAAGCAATTAGATTAAATAGAGAATAGTAATTTATATTAA
AAATCAAATAATTTACATTTATTAGCACATTAATAAGTAAATTAGGATAAAATAATAAAA
GAAATTTAAGAATAGTTAAGTAAACTGAATCAATTAGTAATTAATAACACTAAGAACATA
ATAGAAATATTATAATGGTTGTCATAAGATATAAACAATTTGAATGATAAATCAGTTAAT
GAATAAATTTAGTAATTGCAAATAAGTTTATCAAAATAATTTGTTAAAATTAATTATTAA
AAAATATAATTAATGCTGATAATGTATACTGCAAATAAAAGCTATTCAGATTTTAAAAAG
AACGAATTAATATAATTTTTAGTTGACTTAATAACGATAGAATAAAATAACAAACCAATA
AATAAAAAAAATATTAAATTTGCAAATTAAATTGATAGTTATCCAACAAGTGATGAAGAT
TTAGATTTAGATGAATAAATATTAAAAATAAAACAAGGTTTAGCTATAGAGAGCCAAATT
GAATAATGTAATGATTGGTATGAGATACGAGGAGACGTTGCTAAAATTTTAAAAAAAAGA
GATAAGCCAAATAAGAGATAATTTGAACAAACAGATGAATCAATTTAAAATGAACAATAA
GTTTACAAGTAATTAAAATAATGA