Identifiers and Description

Gene Model Identifier

TTHERM_00670590

Standard Name

UCV2 (homolog to human UBE2V2 (MMS2))

Aliases

PreTt01083 | 100.m00144 | 3731.m00054 | MMS2

Description

ubiquitin-conjugating enzyme E2 variant 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00179 ) Ubiquitin-conjugating enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_00670590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16472.11.0004137340105782e-93ubiquitin-conjugating enzyme f
amily protein (143 aa)
DictyBaseDDB_G02925962.000555387360374e-52ube2v on chromosome: 6 positio
n 1823383 to 1823970
OxytrichaContig716.0.g257.999866353200662e-52Ubiquitin-conjugating enzyme
SGDYGL087C6.002971818577897e-50MMS2 Ubiquitin-conjugating enz
yme variant involved in error-
free postreplication repair; f
orms a heteromeric complex wit
h Ubc13p, an active ubiquitin-
conjugating enzyme; cooperates
with chromatin-associated RIN
G finger proteins, Rad18p and
Rad5p
WormBaseWBGene000067304.997755005759707e-41locus:uev-1 status:Confirmed
UniProt:O45495 protein_id
:CAB07383.1
Stentor CoeruleusSteCoe_192833.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000221
  2. Ref:SUPR000152

Sequences

>TTHERM_00670590(coding)
ATGCAAGAGTCAGTATTTACCATATTAGCAAATGCTTCTTAAATATTAAAGATAATTTAA
AAGAATATTTATCAAAAGAAAAAAGATAATAAATAATATTAGCACATAAAAAAGCAAATA
GTAAAAATGGTTGACGCTGCTAACGCTGTTCCTAGAAGATTCAGACTCCATGAAGAACTT
GAACATGGTGAAAAGGGTATTGGTGATGGAACTGTTTCTTATGGTCTTGATAATCCTGAA
GATATGACCCTTACCAATTGGAATGGTACTATTCTAGGACCTTACAATACTGCTTTTGAT
GGAAGAATTTACTCCCTCAAGATTATTTGTGGACCTAACTATCCCAACGTTGCTCCTGAA
GTTAAATTTGTAAGCAGAATCAACCTTCCTTGCGTAGACCAAAATAATGGAAAGATTGAT
ATCAACAAGTTCCCCATCTTGAAGAACTGGGTTTCTAAATATACTCTCGAAAATGTTTTG
GTTGCTCTTAAAAACGAAATGAACAGCAGTGCTAATAAAAAGCTTAAGCAACCTGATGAA
GGAGCTACCTACTGA


>TTHERM_00670590(protein)
MQESVFTILANASQILKIIQKNIYQKKKDNKQYQHIKKQIVKMVDAANAVPRRFRLHEEL
EHGEKGIGDGTVSYGLDNPEDMTLTNWNGTILGPYNTAFDGRIYSLKIICGPNYPNVAPE
VKFVSRINLPCVDQNNGKIDINKFPILKNWVSKYTLENVLVALKNEMNSSANKKLKQPDE
GATY


>TTHERM_00670590(gene)
ATGCAAGAGTCAGTATTTACCATATTAGCAAGTCAATTCAAATTTTAATGATTTAATCAC
ATGGATTAATTTAATAAAGGAAAGAATGAATAAATGAATGAATGTGTGAGTGAGAGAATA
AAAAGTTTGATAAGTGAATGAAAATATAAATAGATTTGATATTTTTAATTAACTAATTAA
TTAATTATTTGATTTCTTTAAAATAAATAAATAAATAAAATTTTTATATTTTTAATAAAT
ATTATCTTTTTTTATAGGATGGGTTATCTATCTATCTAATTATTATTTAATGAATGAATG
AATCAATTAATAAATTAATTAATTAATTAATTCCTATCTTTCCTTCTTTCTTTTCAATTT
ATTTTTGATTGTTATTATATATAAAAATCATATATAGATGCTTCTTAAATATTAAAGATA
ATTTAAAAGAATATTTATCAAAAGAAAAAAGATAATAAATAATATTAGCACATAAAAAAG
CAAATAGTAAAAATGGGTAAATTCTTGTTTTATAATAGCTTTTTTAAAGATATTAATCAC
ATTTATTTTTTAAAAATATCTTGAATTATAATTTATGCCTCATCAATTAATCTAAAAAAC
CATTATCAAATAGTTGACGCTGCTAACGGTAACTTATTTTCTAAATTTCCTTCTTTAATT
TATTGAATTACCCAAATTTGTATCTAAATCTTCCATTTAATTAATACTTAGCTGTTCCTA
GAAGATTCAGACTCCATGAAGAACTTGAACATGGTGAAAAGGGTATTGGTGATGGAACTG
TTTCTTATGGTCTTGATAATCGTAATAAATTTATTTAAATTTTAGGAAAATCATTATGAT
ATCTAAAAATTGCGAAATTAGATTAAAAATTCAAATGGAAATTTTAAAACTAAAATTTGA
AGCAATAAAAGCAATGAAATTATTAGGATTAGTGATATTTGATTAGTAAATGAAGTATTT
AAAAAGAAAATAAAGCAGTCTTTTTAAAAGAATACAATATTAAAATATATATACTTTTTA
TATGTATTTAAGTCTAATTATTAATTTCATATTATAGCTGAAGATATGACCCTTACCAAT
TGGAATGGTACTATTCTAGGACCTTACAATGTAATTTAGTAGCATCAATCGTGAACTTAT
AATCTTAGACTTATTTTTTAATAAATTTTAGACTGCTTTTGATGGAAGAATTTACTCCCT
CAAGATTATTTGTGGACCTAACTATCCCAACGTTGCTCCTGAAGTTAAATTTGTAAGCAG
AATCAACCTTCCTTGCGTAGACCAAAATAATGGAAAGGTATGAATGAATAATTTAACTAA
AATGCATTTTTCGTAACCTATTAACATAAATATATTAAAAAAGATTGATATCAACAAGTT
CCCCATCTTGAAGAACTGGGTTTCTAAATATACTCTCGAAAATGTTTTGGTTGCTCTTAA
AAACGAAATGAACAGCAGTGCTAATAAAAAGCTTAAGCAACCTGATGAAGGAGCTACCTA
CTGA