Identifiers and Description

Gene Model Identifier

TTHERM_01123950

Standard Name

UCN2 (homolog to human UBE2N (UBC13))

Aliases

PreTt03049 | 244.m00035 | 3834.m00397 | UBC13

Description

E2 ubiquitin-conjugating enzyme family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00179 ) Ubiquitin-conjugating enzyme
  • ( PF05743 ) Tumour susceptibility gene 101 protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01123950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15871.15.002059218654967e-104ubiquitin-conjugating enzyme (
152 aa)
WormBaseWBGene000067084.99966753182923e-69locus:ubc-13 status:Confirme
d UniProt:Q95XX0 protein_i
d:CCD83521.1
DictyBaseDDB_G02772673.0005221502158484e-68ube2n on chromosome: 2 positio
n 7854255 to 7855280
OxytrichaContig14276.0.g394.998816730869543e-67Ubiquitin-conjugating enzyme
SGDYDR092W9.99860868304602e-64UBC13 Ubiquitin-conjugating en
zyme involved in the error-fre
e DNA postreplication repair p
athway; interacts with Mms2p t
o assemble ubiquitin chains at
the Ub Lys-63 residue; DNA da
mage triggers redistribution f
rom the cytoplasm to the nucle
us
Stentor CoeruleusSteCoe_142662.1705220113036395e-29

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000189

Sequences

>TTHERM_01123950(coding)
ATGGCTGGCCCTACTCCTAGAATTATGAAAGAAACTCAAAAGCTTCAAACAGAGCAAGTC
CCTGGTATTGATGTAGTTCCAAATAAGGACAACTTCCGTCACTTCTACGTAAAGATTCAA
GGTCCTGATAACACTCCTTATGCTGGTGGTATCTTCACTGCTGAATTATTATTACCCGAA
TAATATCCTATGAATCCTCCCAAAGTTATTTTCTGCACCAAGATTTATCATCCTAATATT
GATAACCTTGGTAGAATTTGTTTAGATATTTTGAAAGATAAGTGGTCTCCTGCCCTCTAA
ATTCGTTCTGTCCTCCTCTCTATTTAGGCTCTCCTTTCATCCCCCAACCCCGATGATCCT
TTAAATAACGAAGCTGCTGAATAATGGAAAAATGACGAACAAAATGCTTTGAAAAAAGCC
AAGGAATACACTTAAAAGTATGCTACAGGAAAGTGA


>TTHERM_01123950(protein)
MAGPTPRIMKETQKLQTEQVPGIDVVPNKDNFRHFYVKIQGPDNTPYAGGIFTAELLLPE
QYPMNPPKVIFCTKIYHPNIDNLGRICLDILKDKWSPALQIRSVLLSIQALLSSPNPDDP
LNNEAAEQWKNDEQNALKKAKEYTQKYATGK


>TTHERM_01123950(gene)
ATGGCTGGCCCTACTCCTAGAATTATGAAAGTAATTTAAAGCATTTTTTAAATCCTACAA
TAAATATTGATTATTTTTATATATCTATTTAGGAAACTCAAAAGCTTCAAACAGAGCAAG
GTGAACTGACATTAAATTTAAAATATATATACTTTTTCTTCAAAATATATAATTATGTGT
TATTTAATGAGAAATAAAAGCTTAAATAACATATTAAATGCAAAATGCCACAATTATTTT
GAAAATAAATAAAAAAATGCATCAAACGAATTAATATATCTCAATATCAATTCAATAACT
TAAGTTATTTTATATAATAGTCCCTGGTATTGATGTAGTTCCAAATAAGGACAACTTCCG
TCACTTCTACGTAAAGATTCAAGGTCCTGATAACACTCCTTATGCTGGTATATAAAATAT
TACTTTAAGATATATTTTACATCAAATGAAATTAAAAACTAAGAATATATTTTTTTTGGA
ATAGTTTATAGATGCAATTAAAAATTATTTTATTTCTTAATAATCAATTAGGTGGTATCT
TCACTGCTGAATTATTATTACCCGAATAATATCCTATGAATCCTCCCAAAGTTATTTTCT
GCACCAAGATTTATCATCCTAATATTGATAACCTTGGTAGAATTTGTTTAGATATTTTGA
AAGATAAGTGGTCTCCTGCCCTCTAAATTCGTTCTGTCCTCCTCTCTATTTAGGCTCTCC
TTTCATCCCCCAACCGTAAAAACTCATATATTACTTAAAAATATAAATACATAAGCAAAT
AAAAAAGAGATTATAATAGTTACTATGTGCATTTTTCATATATTATTTCATTATTAAATA
GCCGATGATCCTTTAAATAACGAAGCTGCTGAATAATGGAAAAATGACGAACAAAATGCT
TTGAAAAAAGGTAAAAAATTAGCTAATAGTTTAAAAAATTGAATAGCTTAGAGATTATTA
ATATTATTTAGAAGAGGAAGATATGCAATAATATATATTAAAAAGCAATTAAAAATAAAA
AAGAAAACAAAAAAAATAAGATCCTTTATATTATTTAGAAAGGGGTTATTCTACAAAATT
TGCAATTTAAAAACTGCGAAAAAAATTAATAGGAATTTATTTTATTTTGCTTTGAATTTT
TTTACAAAAATTTTATCAATCTTACTTACCAAACTAAAACCAGATTAAAGCATGTAAATA
AGAATACACAAATTAAAATTCTGACTAATCACAATTTTCATAACCTCTCACTCACTCTCT
AAATAATTTAAAATATTTAATATACTTTAATAACATTTTTTTCTTTTAAAAAAGCCAAGG
AATACACTTAAAAGTATGCTACAGGAAAGTGA