Identifiers and Description

Gene Model Identifier

TTHERM_00802330

Standard Name

UBI4 (ubiquitin homolog)

Aliases

136.m00074 | PreTt22704 | 3808.m00362

Description

Ubiquitin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00802330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_242950
WormBaseWBGene000067279.997093137033517e-262locus:ubq-1 status:Confirmed
UniProt:G8JY83 protein_id
:CCD68780.1
DictyBaseDDB_G02823699.997093137033517e-262ubqG on chromosome: 3 position
5878544 to 5879689
OxytrichaContig8023.0.g949.997093137033517e-262Ubiquitin family
SGDYLL039C9.997093137033517e-262UBI4 Ubiquitin, becomes conjug
ated to proteins, marking them
for selective degradation via
the ubiquitin-26S proteasome
system; essential for the cell
ular stress response; encoded
as a polyubiquitin precursor c
omprised of 5 head-to-tail rep
eats
Tetrahymena borealisEI9_14651.13.998941839720987e-159ubiquitin family protein (231
aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000229

Sequences

>TTHERM_00802330(coding)
ATGTAAATTTTTGTTAAGACTTTAACAGGAAAAACTATTACTCTCGATGTTGAAGCTTCT
GACACTATCGAAAATGTCAAAGCTAAGATTCAAGACAAGGAAGGTATTCCTCCTGATCAA
CAAAGACTTATTTTCGCTGGTAAATAACTTGAAGACGGAAGAACCCTTTCTGACTACAAC
ATCCAAAAAGAATCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTT
GTTAAGACTTTGACTGGTAAGACTATTACCTTAGACGTTGAAGCCTCAGATACCATCGAG
AATGTGAAAGCTAAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATC
TTCGCTGGTAAATAACTAGAAGATGGCAGAACTCTTTCTGACTACAACATCCAAAAGGAA
TCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGCAAATCTTTGTTAAGACTTTA
ACAGGTAAAACTATCACTCTCGATGTTGAAGCTTCTGATACTATTGAAAACGTAAAGGCT
AAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATTTTCGCTGGTAAA
TAACTCGAAGACGGAAGAACCCTTTCTGACTACAATATCCAAAAAGAATCAACCCTTCAC
TTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTTGTTAAGACTTTGACTGGTAAGACT
ATTACCTTAGACGTTGAAGCCTCAGATACCATCGAAAATGTGAAGGCTAAGATTCAAGAT
AAGGAAGGTATTCCCCCTGATCAATAAAGACTTATCTTTGCTGGTAAGTAACTCGAAGAC
GGAAGAACCCTTTCTGACTACAACATCCAAAAGGAATCAACTCTTCATTTAGTTTTGAGA
TTAAGAGGTGGTATGTAAATATTCGTTAAGACTTTGACTGGTAAGACCATTACTTTAGAT
GTTGAAGCTTCTGATACTATTGAAAACGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCTCCTGATTAATAAAGACTTATTTTTGCTGGTAAATAACTCGAAGACGGAAGAACCCTT
TCTGACTATAACATTCAAAAGGAATCTACACTTCACTTGGTCCTTAGATTAAGAGGTGGT
TTCTGA


>TTHERM_00802330(protein)
MQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEASDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGF


>TTHERM_00802330(gene)
ATGTAAATTTTTGTTAAGACTTTAACAGGAAAAACTATTACTCTCGATGTTGAAGCTTCT
GACACTATCGAAAATGTCAAAGCTAAGATTCAAGACAAGGAAGGTATTCCTCCTGATCAA
CAAAGACTTATTTTCGCTGGTAAATAACTTGAAGACGGAAGAACCCTTTCTGACTACAAC
ATCCAAAAAGAATCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTT
GTTAAGACTTTGACTGGTAAGACTATTACCTTAGACGTTGAAGCCTCAGATACCATCGAG
AATGTGAAAGCTAAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATC
TTCGCTGGTAAATAACTAGAAGATGGCAGAACTCTTTCTGACTACAACATCCAAAAGGAA
TCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGCAAATCTTTGTTAAGACTTTA
ACAGGTAAAACTATCACTCTCGATGTTGAAGCTTCTGATACTATTGAAAACGTAAAGGCT
AAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATTTTCGCTGGTAAA
TAACTCGAAGACGGAAGAACCCTTTCTGACTACAATATCCAAAAAGAATCAACCCTTCAC
TTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTTGTTAAGACTTTGACTGGTAAGACT
ATTACCTTAGACGTTGAAGCCTCAGATACCATCGAAAATGTGAAGGCTAAGATTCAAGAT
AAGGAAGGTATTCCCCCTGATCAATAAAGACTTATCTTTGCTGGTAAGTAACTCGAAGAC
GGAAGAACCCTTTCTGACTACAACATCCAAAAGGAATCAACTCTTCATTTAGTTTTGAGA
TTAAGAGGTGGTATGTAAATATTCGTTAAGACTTTGACTGGTAAGACCATTACTTTAGAT
GTTGAAGCTTCTGATACTATTGAAAACGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCTCCTGATTAATAAAGACTTATTTTTGCTGGTAAATAACTCGAAGACGGAAGAACCCTT
TCTGACTATAACATTCAAAAGGAATCTACACTTCACTTGGTCCTTAGATTAAGAGGTGGT
TTCTGA