Identifiers and Description

Gene Model Identifier

TTHERM_00802330

Standard Name

UBI4 (UBIquitin homolog 4)

Aliases

136.m00074 | PreTt22704 | 3808.m00362

Description

Ubiquitin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.5%

TetraMine Data

TTHERM_00802330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_242950
WormBaseWBGene000067279.997093137033517e-262locus:ubq-1 status:Confirmed
UniProt:G8JY83 protein_id
:CCD68780.1
DictyBaseDDB_G02823699.997093137033517e-262ubqG on chromosome: 3 position
5878544 to 5879689
OxytrichaContig8023.0.g949.997093137033517e-262Ubiquitin family
SGDYLL039C9.997093137033517e-262UBI4 Ubiquitin, becomes conjug
ated to proteins, marking them
for selective degradation via
the ubiquitin-26S proteasome
system; essential for the cell
ular stress response; encoded
as a polyubiquitin precursor c
omprised of 5 head-to-tail rep
eats
Tetrahymena borealisEI9_14651.13.998941839720987e-159ubiquitin family protein (231
aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000247
  2. Ref:SUPR000229

Sequences

>TTHERM_00802330(coding)
ATGTAAATTTTTGTTAAGACTTTAACAGGAAAAACTATTACTCTCGATGTTGAAGCTTCT
GACACTATCGAAAATGTCAAAGCTAAGATTCAAGACAAGGAAGGTATTCCTCCTGATCAA
CAAAGACTTATTTTCGCTGGTAAATAACTTGAAGACGGAAGAACCCTTTCTGACTACAAC
ATCCAAAAAGAATCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTT
GTTAAGACTTTGACTGGTAAGACTATTACCTTAGACGTTGAAGCCTCAGATACCATCGAG
AATGTGAAAGCTAAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATC
TTCGCTGGTAAATAACTAGAAGATGGCAGAACTCTTTCTGACTACAACATCCAAAAGGAA
TCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGCAAATCTTTGTTAAGACTTTA
ACAGGTAAAACTATCACTCTCGATGTTGAAGCTTCTGATACTATTGAAAACGTAAAGGCT
AAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATTTTCGCTGGTAAA
TAACTCGAAGACGGAAGAACCCTTTCTGACTACAATATCCAAAAAGAATCAACCCTTCAC
TTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTTGTTAAGACTTTGACTGGTAAGACT
ATTACCTTAGACGTTGAAGCCTCAGATACCATCGAAAATGTGAAGGCTAAGATTCAAGAT
AAGGAAGGTATTCCCCCTGATCAATAAAGACTTATCTTTGCTGGTAAGTAACTCGAAGAC
GGAAGAACCCTTTCTGACTACAACATCCAAAAGGAATCAACTCTTCATTTAGTTTTGAGA
TTAAGAGGTGGTATGTAAATATTCGTTAAGACTTTGACTGGTAAGACCATTACTTTAGAT
GTTGAAGCTTCTGATACTATTGAAAACGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCTCCTGATTAATAAAGACTTATTTTTGCTGGTAAATAACTCGAAGACGGAAGAACCCTT
TCTGACTATAACATTCAAAAGGAATCTACACTTCACTTGGTCCTTAGATTAAGAGGTGGT
TTCTGA


>TTHERM_00802330(protein)
MQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEASDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGF


>TTHERM_00802330(gene)
ATGTAAATTTTTGTTAAGACTTTAACAGGAAAAACTATTACTCTCGATGTTGAAGCTTCT
GACACTATCGAAAATGTCAAAGCTAAGATTCAAGACAAGGAAGGTATTCCTCCTGATCAA
CAAAGACTTATTTTCGCTGGTAAATAACTTGAAGACGGAAGAACCCTTTCTGACTACAAC
ATCCAAAAAGAATCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTT
GTTAAGACTTTGACTGGTAAGACTATTACCTTAGACGTTGAAGCCTCAGATACCATCGAG
AATGTGAAAGCTAAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATC
TTCGCTGGTAAATAACTAGAAGATGGCAGAACTCTTTCTGACTACAACATCCAAAAGGAA
TCAACTCTTCACTTAGTTTTGAGATTAAGAGGTGGTATGCAAATCTTTGTTAAGACTTTA
ACAGGTAAAACTATCACTCTCGATGTTGAAGCTTCTGATACTATTGAAAACGTAAAGGCT
AAGATTCAAGATAAGGAAGGTATTCCTCCTGATCAATAAAGACTTATTTTCGCTGGTAAA
TAACTCGAAGACGGAAGAACCCTTTCTGACTACAATATCCAAAAAGAATCAACCCTTCAC
TTAGTTTTGAGATTAAGAGGTGGTATGTAAATTTTTGTTAAGACTTTGACTGGTAAGACT
ATTACCTTAGACGTTGAAGCCTCAGATACCATCGAAAATGTGAAGGCTAAGATTCAAGAT
AAGGAAGGTATTCCCCCTGATCAATAAAGACTTATCTTTGCTGGTAAGTAACTCGAAGAC
GGAAGAACCCTTTCTGACTACAACATCCAAAAGGAATCAACTCTTCATTTAGTTTTGAGA
TTAAGAGGTGGTATGTAAATATTCGTTAAGACTTTGACTGGTAAGACCATTACTTTAGAT
GTTGAAGCTTCTGATACTATTGAAAACGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCTCCTGATTAATAAAGACTTATTTTTGCTGGTAAATAACTCGAAGACGGAAGAACCCTT
TCTGACTATAACATTCAAAAGGAATCTACACTTCACTTGGTCCTTAGATTAAGAGGTGGT
TTCTGA