Identifiers and Description

Gene Model Identifier

TTHERM_00522720

Standard Name

UBC9 (Ubiquitin conjugating enzyme 9)

Aliases

PreTt12387 | 65.m00205 | 3717.m00084

Description

SUMO-conjugating enzyme involved in the Smt3p conjugation pathway; a member of the ubiquitin-conjugating enzyme E2 family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00179 ) Ubiquitin-conjugating enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00522720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12835.12.0009580008310955e-119ubiquitin-conjugating enzyme f
amily protein (168 aa)
OxytrichaContig20855.0.g279.999353957415832e-59Ubiquitin-conjugating enzyme
DictyBaseDDB_G02876939.997652352281279e-57ubc9 on chromosome: 5 position
688286 to 689217
WormBaseWBGene000067066.997794455893953e-54locus:ubc-9 SUMO-conjugating
enzyme UBC9 status:Confirme
d UniProt:Q95017 protein_i
d:CCD70229.1
SGDYDL064W9.998397555368434e-52UBC9 SUMO-conjugating enzyme i
nvolved in the Smt3p conjugati
on pathway; nuclear protein re
quired for S- and M-phase cycl
in degradation and mitotic con
trol; involved in proteolysis
mediated by the anaphase-promo
ting complex cyclosome (APCC)
Stentor CoeruleusSteCoe_143615.900090541597061e-29

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26453653: Yang Q, Nasir AM, Coyne RS, Forney JD (2015) Depletion of UBC9 Causes Nuclear Defects during the Vegetative and Sexual Life Cycles in Tetrahymena thermophila. Eukaryotic cell 14(12):1240-52

Sequences

>TTHERM_00522720(coding)
ATGTAGCAACAAAATAAAGAAGTAAATGAATTAGTTATTACTAGACTAAAATAGGAAAGA
AAGCAATGGCGTCAAGATCATCCTCACAGATTTGTAGCAAAACCCATGACCAAAGAAGAT
GGAACTATCAATATGCTTAAATGGTATTGCGAAATTCCTGGACCAGAAGGCAGTCCATGG
GAAGGTGGTGTTTATATTTTATATATGGATTTCTCTCAATCCTATCCTATAAAGCCTCCT
AAATGTCAATTTAAGCCTGTCCTTCCTCACCCTAATGTCTATCCTTCAGGAACTGTGTGT
CTTTCTATATTAAATGAGGAAGAAGATTGGAAATCAGCTATAACTATTAAATAGATTTTG
ATGGGTATATAAAAATTATTAAAAGATGAGCCTAATATTGATAGTCCTGCTTAATACGAA
CCTTGCGCTCTTTACAGGAGTGATAAAGAAAAATACTATAAAAAAGTAAGAGAATTTGCT
GAAACCATGAAAAAAAAAGACTGA


>TTHERM_00522720(protein)
MQQQNKEVNELVITRLKQERKQWRQDHPHRFVAKPMTKEDGTINMLKWYCEIPGPEGSPW
EGGVYILYMDFSQSYPIKPPKCQFKPVLPHPNVYPSGTVCLSILNEEEDWKSAITIKQIL
MGIQKLLKDEPNIDSPAQYEPCALYRSDKEKYYKKVREFAETMKKKD


>TTHERM_00522720(gene)
ATGTAGCAACAAAATAAAGAAGTAAATGAATTAGTTATTACTAGACTAAAATAGGAAAGA
AAGCAATGGCGTCAAGATCATCCTCACGTAATAATTATTAGTGATTGATTCTTTCTTCAT
TTATCGATTGATAAATGGATGAAGAATAGCAAGCTTGCGTACAATTCGATTCAACAGATA
TTCTTATATTTCATCTATTTAATAAAAATAGAGATTTGTAGCAAAACCCATGACCAAAGA
AGATGGAACTATCAATATGCTTAAATGGTATTGCGAAATTCCTGGACCAGAAGGCGTAAA
AAACCATTTAATTTTTAAAAACTCTTAGATTTCATTTAAAAAAAAAAAAATTGTTAAAAA
TTAACTTTTAAATCAAAAATAATAATTTTTGCGGCATTTCTAATCTATAATACAAAATAA
TATAAAAAATAAAAATAATAATACTAATATATAATAGAGTCCATGGGAAGGTGGTGTTTA
TATTTTATATATGGATTTCTCTCAATCCTATCCTATAAAGCCTCCTAAATGTAAATTAAT
ATATTTGCTAATTAAGTTAGTTATTTTTAATAAATTTAATTTTCTGATGATTAGGTCAAT
TTAAGCCTGTCCTTCCTCACCCTAATGTCTATCCTTCAGGTATTTTAAATATTTAATATA
GTTTTATTTTATAGCAAACTATATTTATGACTTTATTAATTATAAATAAAATTTATTACC
TTAAAATAAGGAACTGTGTGTCTTTCTATATTAAATGAGGAAGAAGATTGGAAATCAGCT
ATAACTATTAAATAGATTTTGATGGGTATATAAAAATTATTAAAAGATGAGCCTAATATT
GATAGTCCTGCTTAATACGAACCTTGCGCTCTTTACAGGTAAACTTAAAAAAAATAAAAA
TTTATTAAAGGAAAATATTATTATTTACAATAGGAGTGATAAAGAAAAATACTATAAAAA
AGTAAGAGAATTTGCTGAAACCATGAAAAAAAAAGACTGA