Identifiers and Description

Gene Model Identifier

TTHERM_00290880

Standard Name

UBC52 (Ubiquitin-conjugating enzyme; UBC5 paralog)

Aliases

PreTt26020 | 26.m00372 | 3688.m00164

Description

Ubiquitin-conjugating enzyme family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00290880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09380.17.001811683013561e-96ubiquitin-conjugating enzyme f
amily protein (149 aa)
OxytrichaContig22519.0.g903.00033207980219e-32Ubiquitin-conjugating enzyme
WormBaseWBGene000023449.995528898049344e-31locus:let-70 Ubiquitin-conju
gating enzyme E2 2 status:Co
nfirmed UniProt:P35129 pro
tein_id:CAA92745.1
DictyBaseDDB_G02905476.001249495680822e-29DDB_G0290547 on chromosome: 5
position 4248317 to 4249423
SGDYDR059C1.000382677035467e-28UBC5 Ubiquitin-conjugating enz
yme that mediates selective de
gradation of short-lived, abno
rmal, or excess proteins, incl
uding histone H3; central comp
onent of the cellular stress r
esponse; expression is heat in
ducible
Stentor CoeruleusSteCoe_177230.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00290880(coding)
ATGAACAAGCGTATGGAAAAGGAATTCGCTGATATCAGCAACAACCCTCCTAAAGGTGTT
TCTATTAAGAAAGGTAACGACCAAACTAAGTGGGAAATCACCATTGCTGGCCCTGAAGGT
AGCGTTTATCATGGTCACAACTTCAAGGTTATCTGCTCCTTCCCTGATAACTATCCTTTC
AAAATGCCTGACTTTGCTTTCGAAACTATGATCTGGCACCCTAACGTAACCGACAAGGGT
GAAGTTTGCAAGGAAATGCTTGGTGAAAAGGAATGGGTTCCCACAAAGTAAGTTAAAACT
GTTATTGAAATTATTGCCTCTATGTTAGCTGAACCTAATGTTGATTCTGCTATCAACAAC
GAAGCTGCTAAGCAATATAAATCTGATCCAAAGGAATTTGAAAAAAAAGCTAAGGAATTT
ATCAATCAATATTGTAAAAAGTGA


>TTHERM_00290880(protein)
MNKRMEKEFADISNNPPKGVSIKKGNDQTKWEITIAGPEGSVYHGHNFKVICSFPDNYPF
KMPDFAFETMIWHPNVTDKGEVCKEMLGEKEWVPTKQVKTVIEIIASMLAEPNVDSAINN
EAAKQYKSDPKEFEKKAKEFINQYCKK


>TTHERM_00290880(gene)
ATGAACAAGCGTATGGAAAAGGAATTCGCTGATATCAGCAACAACCCTCCTAAAGGTGTT
TCTATTAAGAAAGGTAACGACCAAACTAAGTGGGAAATCACCATTGCTGGCCCTGAAGGT
AGCGTTTATCATGGTCACAACTTCAAGGTTATCTGCTCCTTCCCTGATAACTATCCTTTC
AAAATGCCTGACTTTGCTTTCGAAACTATGATCTGGCACCCTAACGTAACCGACAAGGGT
GAAGTTTGCAAGGAAATGCTTGGTGAAAAGGAATGGGTTCCCACAAAGTAAGTTAAAACT
GTTATTGAAATTATTGCCTCTATGTTAGCTGAACCTAATGTTGATTCTGCTATCAACAAC
GAAGCTGCTAAGCAATATAAATCTGATCCAAAGGAATTTGAAAAAAAAGCTAAGGAATTT
ATCAATCAATATTGTAAAAAGTGA