Identifiers and Description

Gene Model Identifier

TTHERM_01082940

Standard Name

UBC5 (Ubiquitin-conjugating enzyme; UBC5 ortholog)

Aliases

PreTt17868 | 224.m00038

Description

Ubiquitin-conjugating enzyme family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF05773 ) RWD domain
  • ( PF00179 ) Ubiquitin-conjugating enzyme
  • ( PF05743 ) Tumour susceptibility gene 101 protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_01082940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02943.17.99892222111879e-127hypothetical protein (447 aa)
SGDYDR059C3.99801309251602e-27UBC5 Ubiquitin-conjugating enz
yme that mediates selective de
gradation of short-lived, abno
rmal, or excess proteins, incl
uding histone H3; central comp
onent of the cellular stress r
esponse; expression is heat in
ducible
WormBaseWBGene000023442.000130478826482e-26locus:let-70 Ubiquitin-conju
gating enzyme E2 2 status:Co
nfirmed UniProt:P35129 pro
tein_id:CAA92745.1
OxytrichaContig13807.0.g1101.999790113608142e-24Ubiquitin-conjugating enzyme
DictyBaseDDB_G02905472.000620012690291e-23DDB_G0290547 on chromosome: 5
position 4248317 to 4249423
Stentor CoeruleusSteCoe_296080.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01082940(coding)
ATGAGTCAATAATAATAATATAAAGGAAAATGTAATTGCCCTTTTTGCTCTAGATTTAAT
AAAATGTAGGGAGAAATAAACAGAGATGAAATAGAGGAATCTAAAGAAAATTAATCTAAT
TCATATTCCTAAAATTATTAATAATATGAAAAATTAAAAAGTTCATAAGTATAACAAGAT
GAAAATGACCAAAATTAATATGTTTAAAATAACCAATAATATGAAATCTAACAAAATTAA
AATGATTAAAATAACCAAAATAATCCCTTATATGACTAACCATTTAAATTTGAAGTAAAT
CATAATATAGATAATGATTTATAAATGATTAAAGATTGGATAGGTCAATTTTCTAATTTA
AAAGATGTTCAACAATAAAACGAAGCCAGTCATGATTTTATGCAAAATTTTGTGACATAA
TACCCTACCTCTGATTTATCATTACCAGATATTTCCTTTCATTTCAAACCTGATGGATCA
TAAGCTATCCTCTTTAGCATTTTCTGTTAACCTGAAATACTATAAAAGTGTGTAGCTAAA
AGAAATGATATAGCGGAATTATTTTATGACTCAATAGGTTTCACTATACTTTTAGTTATT
AAGCCTAAAATTGACTATAAGAATTTTGACTAAAAACATTAAGAATTTAATTCTAATGAG
ATACCTCTGGAGGTTTTTATTTCTAACAAGTTTGAGAGTTAATAAAAGATCTTATACAAA
ATAGGCTTGTAAGCAAAAAGGTAAATAAAGGTATTCCCTCAAATCTAAAATTTAAGACTT
AGAAGAGATTTAAATGAATTGTTTGAGTGTTTAGATGATAAATTTGAATTTAACTATTCT
AATTGCAGTGATCACTGTTTCGCTTACTACACTTAGTCAGATAATTTAAATTAGCTTGAA
GGCTTGATCATAGGTCCACAAGACACTCCTTACGAAGGAATACCCTACACTGTTACTATT
TAAATACCTGATTAATACCCTATTGAGCCTCCCAAAGTTACTTTCAACTAGTAAATTCTG
CATCCAAACATCAGTGAATAAGGAGAAATATGTCTAAATATTCTCTAAGATAAATGGAGT
ACAGTGCTTACCATTTAAAAAGTGCTTGTAAGTATAGTCAGTTTACTTTATGAAAAGAAT
TTAGATGATGTTTATAATCACTATGCAAAAACCCTATATCAAGAAGATCCTGAAGAATAC
AAAACTTTAATTAAAAAATAATCCATATTGCAAGATAGCCAAAAGCTAAAAATTGACTTC
AAATAATTGGCAAAAGTACCCATAAATGAATAAAATGGATATGATGAATATGAAAATAAC
GATGGCTATAATACTTATGAAGGATATGATGATGATGATTACTAATATATGGATATAGAA
GATGAATGA


>TTHERM_01082940(protein)
MSQQQQYKGKCNCPFCSRFNKMQGEINRDEIEESKENQSNSYSQNYQQYEKLKSSQVQQD
ENDQNQYVQNNQQYEIQQNQNDQNNQNNPLYDQPFKFEVNHNIDNDLQMIKDWIGQFSNL
KDVQQQNEASHDFMQNFVTQYPTSDLSLPDISFHFKPDGSQAILFSIFCQPEILQKCVAK
RNDIAELFYDSIGFTILLVIKPKIDYKNFDQKHQEFNSNEIPLEVFISNKFESQQKILYK
IGLQAKRQIKVFPQIQNLRLRRDLNELFECLDDKFEFNYSNCSDHCFAYYTQSDNLNQLE
GLIIGPQDTPYEGIPYTVTIQIPDQYPIEPPKVTFNQQILHPNISEQGEICLNILQDKWS
TVLTIQKVLVSIVSLLYEKNLDDVYNHYAKTLYQEDPEEYKTLIKKQSILQDSQKLKIDF
KQLAKVPINEQNGYDEYENNDGYNTYEGYDDDDYQYMDIEDE


>TTHERM_01082940(gene)
ATGAGTCAATAATAATAATATAAAGGAAAATGTAATTGCCCTTTTTGCTCTAGATTTAAT
AAAATGTAGGGAGAAATAAACAGAGATGAAATAGAGGAATCTAAAGAAAATTAATCTAAT
TCATATTCCTAAAATTATTAATAATATGAAAAATTAAAAAGTTCATAAGTATAACAAGAT
GAAAATGACCAAAATTAATATGTTTAAAATAACCAATAATATGAAATCTAACAAAATTAA
AATGATTAAAATAACCAAAATAATCCCTTATATGACTAACCATTTAAATTTGAAGTAAAT
CATAATATAGATAATGATTTATAAATGATTAAAGATTGGATAGGTCAATTTTCTAATTTA
AAAGATGTTCAACAATAAAACGAAGCCAGTCATGATTTTATGCAAAATTTTGTGACATAA
TACCCTACCTCTGATTTATCATTACCAGATATTTCCTTTCATTTCAAACCTGATGGATCA
TAAGCTATCCTCTTTAGCATTTTCTGTTAACCTGAAATACTATAAAAGTGTGTAGCTAAA
AGAAATGATATAGCGGAATTATTTTATGACTCAATAGGTTTCACTATACTTTTAGTTATT
AAGCCTAAAATTGACTATAAGAATTTTGACTAAAAACATTAAGAATTTAATTCTAATGAG
ATACCTCTGGAGGTTTTTATTTCTAACAAGTTTGAGAGTTAATAAAAGATCTTATACAAA
ATAGGCTTGTAAGCAAAAAGGTAAATAAAGGTATTCCCTCAAATCTAAAATTTAAGACTT
AGAAGAGATTTAAATGAATTGTTTGAGTGTTTAGATGATAAATTTGAATTTAACTATTCT
AATTGCAGTGATCACTGTTTCGCTTACTACACTTAGTCAGATAATTTAAATTAGCTTGAA
GGCTTGATCATAGGTCCACAAGACACTCCTTACGAAGGAATACCCTACACTGTTACTATT
TAAATACCTGATTAATACCCTATTGAGCCTCCCAAAGTTACTTTCAACTAGTAAATTCTG
CATCCAAACATCAGTGAATAAGGAGAAATATGTCTAAATATTCTCTAAGATAAATGGAGT
ACAGTGCTTACCATTTAAAAAGTGCTTGTAAGTATAGTCAGTTTACTTTATGAAAAGAAT
TTAGATGATGTTTATAATCACTATGCAAAAACCCTATATCAAGAAGATCCTGAAGAATAC
AAAACTTTAATTAAAAAATAATCCATATTGCAAGATAGCCAAAAGCTAAAAATTGACTTC
AAATAATTGGCAAAAGTACCCATAAATGAATAAAATGGATATGATGAATATGAAAATAAC
GATGGCTATAATACTTATGAAGGATATGATGATGATGATTACTAATATATGGATATAGAA
GATGAATGA