Identifiers and Description

Gene Model Identifier

TTHERM_00218380

Standard Name

UBC45 (Ubiquitin-conjugating enzyme 4 paralog)

Aliases

PreTt22265 | 18.m00291 | 3701.m00051

Description

Ubiquitin-conjugating enzyme family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00179 ) Ubiquitin-conjugating enzyme
  • ( TIGR00126 ) deoxyribose-phosphate aldolase
  • ( PF00092 ) von Willebrand factor type A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00218380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06610.19.997093137033517e-262ubiquitin-conjugating enzyme f
amily protein (602 aa)
DictyBaseDDB_G02886972.000597631390999e-64DDB_G0288697 on chromosome: 5
position 1839851 to 1841692
Stentor CoeruleusSteCoe_358803.720075976020836e-44
SGDYDR059C2.998863950472602e-38UBC5 Ubiquitin-conjugating enz
yme that mediates selective de
gradation of short-lived, abno
rmal, or excess proteins, incl
uding histone H3; central comp
onent of the cellular stress r
esponse; expression is heat in
ducible
WormBaseWBGene000023443.9997566980151843e-38locus:let-70 Ubiquitin-conju
gating enzyme E2 2 status:Co
nfirmed UniProt:P35129 pro
tein_id:CAA92745.1
OxytrichaContig13807.0.g1102.9995979253168707e-35Ubiquitin-conjugating enzyme

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00218380(coding)
ATGGACCAAGAAGCAGAAGTTATAGTATCAAGCTCTTAAGCTTCTAATTTCATCATAAAA
GTTTAAATTAATGAATTTAAATTTAAGTTCTAAGTTAAAGACCCTTAACAAAAGATTTAG
TAGCTAAGATATGAGTTAATAGAACATTTAAAGAAACTAAACTACAATCTTTAAGATGAA
GCATATAGTTGTTATTCACTTGCTGACGACTAAGAGTTTGTGCTTTCTGAAGATGATGCT
GTTTCAAGCTTAATTTCTCACAATGACCTAGTTAAGATGGTATCTAAAGTTAAATAAGAA
TAGGATTAGCCGATTTAAGTAGAATAATAGAAAGAGGAAGATCCTAAAGAGGCAATAGTA
ATTTTGTATGATATTTCAGGTTCTATGGGATCAACATTTTATAATGAGTAAGGCTTACCT
AGAATAGGAGCAGTTAATGCCTTTTTCTCTGCTTTTGCTGATAAAACACTTGCTATGGAG
TACAATCACGTAGTTTCACTTTTTTGGTTTGACAGTAAGATAGAAAAAAAATGTGAATTT
ATCAGAGATATGAATACGTTTATCAAGCTAGTAGATGATGCTGCTCCAAGAGGTGGTACT
CGTCTGTATGATTCTTTAGTTGAAGGAGTCAACAGTTTAATAGAATACAAGAAAAAGCAC
CCTAACACTATTTTACGTATGATTGCCCTTACTGATGGTGAAGACAATGAATCTAAATAT
AAACCTGGTGAAGTTGCAGCTTTGATATTAAAAAATCGTATTATATTAGACTCATTTGTT
GTAAGTTAATAAAGCTTGTAATTAAAAGCAATCACTCATGCGAGTGGTGGTAGATGTTAT
TGCCCAGCCTCTATAAATGATGGTTTAAAATTATTTGAAATAGAAACAATCCTATCTGTT
CGTGCAAGGGACATTAATTTCGAAGAGTTTTACTCAAAGAGTGTTTAATAATGTGACACT
GATTAATTTATTAATTTAGACAGATTCTAGTCACTTCCTTTTGATACAGAAGGTATTTAA
GTTAGTTATGATAAGTAAATTTAGCAGCCTGCTGCAGACATTAGTCATATTATAGCAAAG
TACTCCAAAATTGCTAACAATCCAACTTAACCATCATCATCCTCTACCTCGAGTACTGGA
GCTAGTATTAATTAATAAGGACCTAGTTAAGCAGTTTTAAAAAGAATAGTCAAAGAATTA
GAAACTATTTAAAAGGAAACTGACCCTAATTTTAAGGCTAAAGTATTCCCTGCAGAAAAT
GATATAATGAACTGGAAGGTGCTATTAATAGGTCCTGAAGGAACAACATACAATTATGGA
GTCTTTATGGTTTATATAACTTTTCCAAATGACTATCCCTTTAAACCTCCTCGTACCCGT
TTTATAACTCCCATATATCACCCAAATATAAGCTCCTAGGGACATATGTGCTTAGATATT
CTAAAAGATTAATGGTCCCCAGCCTTAACTATCTAAAAATCACTAAATAGTTTTTTGTCC
TTAATGCAAGATCCTAACCCAAATGATGCTCTTGATAGTACTATTGCAGCATAATATCTT
GATGATATTAACATATTTAAATAGAAGTGCCTAGATCACATTAAGCAATATGCTAATAAA
TCAGTAGACGAATTGATGGTTGACATAATGGGAACTTCATTGGATGTTAAAAGCGAATTC
TATGTTAATACTCATGCTGAATTAAAACAATGGATTAATTCAAATAAAGCTAAATTTTGA


>TTHERM_00218380(protein)
MDQEAEVIVSSSQASNFIIKVQINEFKFKFQVKDPQQKIQQLRYELIEHLKKLNYNLQDE
AYSCYSLADDQEFVLSEDDAVSSLISHNDLVKMVSKVKQEQDQPIQVEQQKEEDPKEAIV
ILYDISGSMGSTFYNEQGLPRIGAVNAFFSAFADKTLAMEYNHVVSLFWFDSKIEKKCEF
IRDMNTFIKLVDDAAPRGGTRLYDSLVEGVNSLIEYKKKHPNTILRMIALTDGEDNESKY
KPGEVAALILKNRIILDSFVVSQQSLQLKAITHASGGRCYCPASINDGLKLFEIETILSV
RARDINFEEFYSKSVQQCDTDQFINLDRFQSLPFDTEGIQVSYDKQIQQPAADISHIIAK
YSKIANNPTQPSSSSTSSTGASINQQGPSQAVLKRIVKELETIQKETDPNFKAKVFPAEN
DIMNWKVLLIGPEGTTYNYGVFMVYITFPNDYPFKPPRTRFITPIYHPNISSQGHMCLDI
LKDQWSPALTIQKSLNSFLSLMQDPNPNDALDSTIAAQYLDDINIFKQKCLDHIKQYANK
SVDELMVDIMGTSLDVKSEFYVNTHAELKQWINSNKAKF


>TTHERM_00218380(gene)
ATGGACCAAGAAGCAGAAGTTATAGTATCAAGCTCTTAAGCTTCTAATTTCATCATAAAA
GTTTAAATTAATGAATTTAAATTTAAGTTCTAAGTTAAAGACCCTTAACAAAAGATTTAG
TAGCTAAGATATGAGTTAATAGAACATTTAAAGAAACTAAACTACAATCTTTAAGATGAA
GCATATAGTTGTTATTCACTTGCTGACGACTAAGAGTTTGTGCTTTCTGAAGATGATGCT
GTTTCAAGCTTAATTTCTCACAATGACCTAGTTAAGATGGTATCTAAAGTTAAATAAGAA
TAGGATTAGCCGATTTAAGTAGAATAATAGAAAGAGGAAGATCCTAAAGAGGCAATAGTA
ATTTTGTATGATATTTCAGGTTCTATGGGATCAACATTTTATAATGAGTAAGGCTTACCT
AGAATAGGAGCAGTTAATGCCTTTTTCTCTGCTTTTGCTGATAAAACACTTGCTATGGAG
TACAATCACGTAGTTTCACTTTTTTGGTTTGACAGTAAGATAGAAAAAAAATGTGAATTT
ATCAGAGATATGAATACGTTTATCAAGCTAGTAGATGATGCTGCTCCAAGAGGTGGTACT
CGTCTGTATGATTCTTTAGTTGAAGGAGTCAACAGTTTAATAGAATACAAGAAAAAGCAC
CCTAACACTATTTTACGTATGATTGCCCTTACTGATGGTGAAGACAATGAATCTAAATAT
AAACCTGGTGAAGTTGCAGCTTTGATATTAAAAAATCGTATTATATTAGACTCATTTGTT
GTAAGTTAATAAAGCTTGTAATTAAAAGCAATCACTCATGCGAGTGGTGGTAGATGTTAT
TGCCCAGCCTCTATAAATGATGGTTTAAAATTATTTGAAATAGAAACAATCCTATCTGTT
CGTGCAAGGGACATTAATTTCGAAGAGTTTTACTCAAAGAGTGTTTAATAATGTGACACT
GATTAATTTATTAATTTAGACAGATTCTAGTCACTTCCTTTTGATACAGAAGGTATTTAA
GTTAGTTATGATAAGTAAATTTAGCAGCCTGCTGCAGACATTAGTCATATTATAGCAAAG
TACTCCAAAATTGCTAACAATCCAACTTAACCATCATCATCCTCTACCTCGAGTACTGGA
GCTAGTATTAATTAATAAGGACCTAGTTAAGCAGTTTTAAAAAGAATAGTCAAAGAATTA
GAAACTATTTAAAAGGAAACTGACCCTAATTTTAAGGCTAAAGTATTCCCTGCAGAAAAT
GATATAATGAACTGGAAGGTGCTATTAATAGGTCCTGAAGGAACAACATACAATTATGGA
GTCTTTATGGTTTATATAACTTTTCCAAATGACTATCCCTTTAAACCTCCTCGTACCCGT
TTTATAACTCCCATATATCACCCAAATATAAGCTCCTAGGGACATATGTGCTTAGATATT
CTAAAAGATTAATGGTCCCCAGCCTTAACTATCTAAAAATCACTAAATAGTTTTTTGTCC
TTAATGCAAGATCCTAACCCAAATGATGCTCTTGATAGTACTATTGCAGCATAATATCTT
GATGATATTAACATATTTAAATAGAAGTGCCTAGATCACATTAAGCAATATGCTAATAAA
TCAGTAGACGAATTGATGGTTGACATAATGGGAACTTCATTGGATGTTAAAAGCGAATTC
TATGTTAATACTCATGCTGAATTAAAACAATGGATTAATTCAAATAAAGCTAAATTTTGA