Identifiers and Description

Gene Model Identifier

TTHERM_01341620

Standard Name

UBC4 (Ubiquitin-conjugating enzyme; UBC4 ortholog)

Aliases

PreTt12827 | 335.m00021

Description

Ubiquitin-conjugating enzyme family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00179 ) Ubiquitin-conjugating enzyme
  • ( PF00092 ) von Willebrand factor type A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.7%

TetraMine Data

TTHERM_01341620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10011.19.997093137033517e-262ubiquitin-conjugating enzyme f
amily protein (597 aa)
DictyBaseDDB_G02886977.998673901528599e-62DDB_G0288697 on chromosome: 5
position 1839851 to 1841692
Stentor CoeruleusSteCoe_358803.0144087850653746e-40
SGDYBR082C8.002251789887453e-32UBC4 Ubiquitin-conjugating enz
yme (E2), mediates degradation
of abnormal or excess protein
s, including calmodulin and hi
stone H3; interacts with many
SCF ubiquitin protein ligases;
component of the cellular str
ess response
WormBaseWBGene000023441.999981404597394e-31locus:let-70 Ubiquitin-conju
gating enzyme E2 2 status:Co
nfirmed UniProt:P35129 pro
tein_id:CAA92745.1
OxytrichaContig4987.0.g182.000470901975128e-28Ubiquitin-conjugating enzyme

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01341620(coding)
ATGGAAGGAAATCTTAAGTCAATCAGAGTTTAATTTGAGGCAAATAAATTCAAACAGGTC
ATTACCTAGCCAGATCAGACTATTGGAGAACTCAAATCTCTTCTCTTAGCTAGGTTGTCT
GAATTAATTAAGGGTTAAACTTTTGATGCTCAAAGTTTTTTGTTAGCGGATGAGGACGAG
TTTGCTTTTTCAGATTCTGACATAGTTTCTTCGCTCATAAATTAAAATGACCTAGTTAAG
ATCATTGTAAATCAAACAGTTTTACAGTAATAGTAAGAGTAAAACAATTAAAATGCATAG
AATATCTAAAAATAAACAGATACAACAAACTAAGATCAAGTGAATCAAGAGTAGCAAGGT
CAATTAAATTAGGTTGAGTTATAATACAAGGAAGAAGATCCAGCTGAGGCTATTGTAGTT
ATTTATGATGTCTCTGGGTCTATGAAATCTGGGTTCTTTAATGACCCTTTGATTTCGAGA
ATTGGTGCTGTAAATGCATTTTTTTCAGCATTCGCTGATAAAACTTTAGCCTACGAATAT
AATCATATTGTTCAGCTATATTGGTTCGATGATAGGATTGAAAAGAAATGCGATTTTACT
AAAGATATGAATCATTTTATCAAACTTGTCGATGATGCTAATCCAAGAGGATCTACTCGT
TTATATGATGCCCTAATGGAGGGTATTAACAGTCTTCTACTAATAAAAAAGAAATATCCA
AACATTATTCTGAGACTGATTGCAATGACTGATGGAGAAGACAACTAATCTAAATACAAG
CCAGAAGAAGTTGCTAAATAGATCGTTATGAATAGGATTACTCTCGACTCCTTTGTTGTC
TCTAAGGAGAGTTTTGGACTTAAAACAATCACTCATGCAAGCGGTGGTCGCTGCTATTGT
CCTTAAGATCTCGCCGTTGGAATGAAATTATTTGAAATTGAAACTATATTATCAGTAAGA
GCAAGAGATTTACCTAATAGTAATAATTTGCCTTTACAAAATGTAGAAATCAATTTAGAT
ATCCTTCGTGACAAACCCTTTGACACAGAAGGAATCTAAGTAACTCATCAAGCATAAATC
AGCAAATAAGCTGGCGATGTCTCAGACATTATTAAGAAGTATTAAAAAGTTATTTCCCAA
CCTCCTTAGAACAATTAATAGCAACCATAATCATCATCAGCATCAACTACAGCACAATAG
AATTAAATAAGCCATAGCAGCGGTTGCATGAAAAGGCTAATAAGAGAACTAGAGTTTTTC
CCTTAGTAGCCAGAAACCTATAAAGTAAAAGTCTTTCCCGAATAAGATGATATTACAAAC
TGGAAGGTATTAATGATTGGTCCAGAAGGCTCTAGCTACCATTAAGGTGTTTATATGCTC
TATATCAACTTTCCTTAATCCTATCCTTTTAAACCTCCTTCTGTAAAATTTATTACTCCC
ATATATCATTGCAATGTCAATTCTCAAGGTAGAATTTGCATTGATATTCTTAAAGACAAT
TGGTCACCAGCTTTAACTATGGCTGCAGTTTTTAACTCAATAAGCGAATTGATGCTTCAT
CCAAACCCAATAGATGCCTTAGAGAGCAATATAGCAGCAGAAATGAACCATGAGTACGAT
CTTTACAAGTAGAAGTGTCTTTAGCATGTAGCAAATAATGCTAATAAACCTATGGAGCTA
TTAATGGAGGAAATCTTTGGTAAACAAGTTGACACTAGCTCAGAAGTTTATATCAAAACA
AAAGTTTAGTTAACAAACTGGATATAAAATAATAAATTACCATGCTAAAAAGAGCAAAAC
CACTGA


>TTHERM_01341620(protein)
MEGNLKSIRVQFEANKFKQVITQPDQTIGELKSLLLARLSELIKGQTFDAQSFLLADEDE
FAFSDSDIVSSLINQNDLVKIIVNQTVLQQQQEQNNQNAQNIQKQTDTTNQDQVNQEQQG
QLNQVELQYKEEDPAEAIVVIYDVSGSMKSGFFNDPLISRIGAVNAFFSAFADKTLAYEY
NHIVQLYWFDDRIEKKCDFTKDMNHFIKLVDDANPRGSTRLYDALMEGINSLLLIKKKYP
NIILRLIAMTDGEDNQSKYKPEEVAKQIVMNRITLDSFVVSKESFGLKTITHASGGRCYC
PQDLAVGMKLFEIETILSVRARDLPNSNNLPLQNVEINLDILRDKPFDTEGIQVTHQAQI
SKQAGDVSDIIKKYQKVISQPPQNNQQQPQSSSASTTAQQNQISHSSGCMKRLIRELEFF
PQQPETYKVKVFPEQDDITNWKVLMIGPEGSSYHQGVYMLYINFPQSYPFKPPSVKFITP
IYHCNVNSQGRICIDILKDNWSPALTMAAVFNSISELMLHPNPIDALESNIAAEMNHEYD
LYKQKCLQHVANNANKPMELLMEEIFGKQVDTSSEVYIKTKVQLTNWIQNNKLPCQKEQN
H


>TTHERM_01341620(gene)
ATGGAAGGAAATCTTAAGTCAATCAGAGTTTAATTTGAGGCAAATAAATTCAAACAGGTC
ATTACCTAGCCAGATCAGACTATTGGAGAACTCAAATCTCTTCTCTTAGCTAGGTTGTCT
GAATTAATTAAGGGTTAAACTTTTGATGCTCAAAGTTTTTTGTTAGCGGATGAGGACGAG
TTTGCTTTTTCAGATTCTGACATAGTTTCTTCGCTCATAAATTAAAATGACCTAGTTAAG
ATCATTGTAAATCAAACAGTTTTACAGTAATAGTAAGAGTAAAACAATTAAAATGCATAG
AATATCTAAAAATAAACAGATACAACAAACTAAGATCAAGTGAATCAAGAGTAGCAAGGT
CAATTAAATTAGGTTGAGTTATAATACAAGGAAGAAGATCCAGCTGAGGCTATTGTAGTT
ATTTATGATGTCTCTGGGTCTATGAAATCTGGGTTCTTTAATGACCCTTTGATTTCGAGA
ATTGGTGCTGTAAATGCATTTTTTTCAGCATTCGCTGATAAAACTTTAGCCTACGAATAT
AATCATATTGTTCAGCTATATTGGTTCGATGATAGGATTGAAAAGAAATGCGATTTTACT
AAAGATATGAATCATTTTATCAAACTTGTCGATGATGCTAATCCAAGAGGATCTACTCGT
TTATATGATGCCCTAATGGAGGGTATTAACAGTCTTCTACTAATAAAAAAGAAATATCCA
AACATTATTCTGAGACTGATTGCAATGACTGATGGAGAAGACAACTAATCTAAATACAAG
CCAGAAGAAGTTGCTAAATAGATCGTTATGAATAGGATTACTCTCGACTCCTTTGTTGTC
TCTAAGGAGAGTTTTGGACTTAAAACAATCACTCATGCAAGCGGTGGTCGCTGCTATTGT
CCTTAAGATCTCGCCGTTGGAATGAAATTATTTGAAATTGAAACTATATTATCAGTAAGA
GCAAGAGATTTACCTAATAGTAATAATTTGCCTTTACAAAATGTAGAAATCAATTTAGAT
ATCCTTCGTGACAAACCCTTTGACACAGAAGGAATCTAAGTAACTCATCAAGCATAAATC
AGCAAATAAGCTGGCGATGTCTCAGACATTATTAAGAAGTATTAAAAAGTTATTTCCCAA
CCTCCTTAGAACAATTAATAGCAACCATAATCATCATCAGCATCAACTACAGCACAATAG
AATTAAATAAGCCATAGCAGCGGTTGCATGAAAAGGCTAATAAGAGAACTAGAGTTTTTC
CCTTAGTAGCCAGAAACCTATAAAGTAAAAGTCTTTCCCGAATAAGATGATATTACAAAC
TGGAAGGTATTAATGATTGGTCCAGAAGGCTCTAGCTACCATTAAGGTGTTTATATGCTC
TATATCAACTTTCCTTAATCCTATCCTTTTAAACCTCCTTCTGTAAAATTTATTACTCCC
ATATATCATTGCAATGTCAATTCTCAAGGTAGAATTTGCATTGATATTCTTAAAGACAAT
TGGTCACCAGCTTTAACTATGGCTGCAGTTTTTAACTCAATAAGCGAATTGATGCTTCAT
CCAAACCCAATAGATGCCTTAGAGAGCAATATAGCAGCAGAAATGAACCATGAGTACGAT
CTTTACAAGTAGAAGTGTCTTTAGCATGTAGCAAATAATGCTAATAAACCTATGGAGCTA
TTAATGGAGGAAATCTTTGGTAAACAAGTTGACACTAGCTCAGAAGTTTATATCAAAACA
AAAGTTTAGTTAACAAACTGGATATAAAATAATAAATTACCATGCTAAAAAGAGCAAAAC
CACTGA