Identifiers and Description

Gene Model Identifier

TTHERM_00550720

Standard Name

UBC2 (E2 ubiquitin-conjugating enzyme Ubc2, RAD6 ortholog)

Aliases

PreTt29180 | 72.m00103 | RAD6

Description

E2 ubiquitin-conjugating enzyme

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00550720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07360.12.0004261429631518e-110ubiquitin-conjugating enzyme f
amily protein (152 aa)
DictyBaseDDB_G02757877.000472351131044e-82rad6 on chromosome: 2 position
5646909 to 5648070
WormBaseWBGene000067017.002185723491005e-79locus:ubc-1 Ubiquitin-conjug
ating enzyme E2 1 status:Con
firmed UniProt:P52478 prot
ein_id:CCD66736.1
OxytrichaContig16539.0.g1156.002203762674495e-72Ubiquitin-conjugating enzyme
SGDYGL058W1.99927841627239e-68RAD6 Ubiquitin-conjugating enz
yme (E2), involved in postrepl
ication repair (as a heterodim
er with Rad18p), DSBR and chec
kpoint control (as a heterodim
er with Bre1p), ubiquitin-medi
ated N-end rule protein degrad
ation (as a heterodimer with U
br1p
Stentor CoeruleusSteCoe_159651.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19822522: Wang Z, Cui B, Gorovsky MA (2009) Histone H2B ubiquitylation is not required for histone H3 methylation at lysine 4 in tetrahymena. The Journal of biological chemistry 284(50):34870-9
  2. Ref:SUPR000159

Sequences

>TTHERM_00550720(coding)
ATGACAACAGCTGCTAAGAGAAGATTACTTAGAGATTTCAAGAAATTGCAAGATGATCCA
CCAAATGGATTAACTGCTACTCCTATGGAAGATAATATAATGAACTGGGATGCAGTAATT
TTTGGTCCAGAAGACACACCTTGGGAAGGTGCAACATTCAGATTAACATTAGAGTTCACT
GAGGATTATCCCAATAAGCCACCTACTGTTAGATTTAAAACTACCATATTCCACCCTAAT
GTATACAACGATGGATCTATATGTTTAGACATTCTTTAAAACTAATGGAGTCCTATTTAC
GATGTTTGGGCCATCCTCACATCTATACGTTCACTTCTTTGTGATCCAAATCCAAATAGT
CCTGCCAATAGCGAAGCAGCCAAATTGTATTAAGAAGATCGCAAAGAATATATTCGTAGA
GTAAAGGAAATAGTAGAAATGAGCTGGAATTACTGA


>TTHERM_00550720(protein)
MTTAAKRRLLRDFKKLQDDPPNGLTATPMEDNIMNWDAVIFGPEDTPWEGATFRLTLEFT
EDYPNKPPTVRFKTTIFHPNVYNDGSICLDILQNQWSPIYDVWAILTSIRSLLCDPNPNS
PANSEAAKLYQEDRKEYIRRVKEIVEMSWNY


>TTHERM_00550720(gene)
ATGACAACAGCTGCTAAGAGAAGATTACTTAGAGATTTCAAGAAATTGCAAGATGATCCA
CCAAATGGATTAACTGCTACTCCTATGGAAGATAATATAATGAACTGGGATGCAGTAATT
TTTGGTCCAGAAGACACACCTTGGGAAGGTGCAACATTCAGATTAACATTAGAGTTCACT
GAGGATTATCCCAATAAGCCACCTACTGTTAGATTTAAAACTACCATATTCCACCCTAAT
GTATACAACGATGGATCTATATGTTTAGACATTCTTTAAAACTAATGGAGTCCTATTTAC
GATGTTTGGGCCATCCTCACATCTATACGTTCACTTCTTTGTGATCCAAATCCAAATAGT
CCTGCCAATAGCGAAGCAGCCAAATTGTATTAAGAAGATCGCAAAGAATATATTCGTAGA
GTAAAGGAAATAGTAGAAATGAGCTGGAATTACTGA