Identifiers and Description

Gene Model Identifier

TTHERM_000550712

Standard Name

UBC2 (E2 UBiquitin-Conjugating enzyme)

Aliases

None

Description

E2 ubiquitin-conjugating enzyme; promotes post replication repair; ortholog of yeast RAD6

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_000550712

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19822522: Wang Z, Cui B, Gorovsky MA (2009) Histone H2B ubiquitylation is not required for histone H3 methylation at lysine 4 in tetrahymena. The Journal of biological chemistry 284(50):34870-9
  2. Ref:SUPR000207
  3. Ref:SUPR000159

Sequences

>TTHERM_000550712(coding)
ATGACAACAGCTGCTAAGAGAAGATTACTTAGAGATTTCAAGAAATTGCAAGATGATCCA
CCAAATGGATTAACTGCTACTCCTATGGAAGATAATATAATGAACTGGGATGCAGTAATT
TTTGGTCCAGAAGACACACCTTGGGAAGGTGCAACATTCAGATTAACATTAGAGTTCACT
GAGGATTATCCCAATAAGCCACCTACTGTTAGATTTAAAACTACCATATTCCACCCTAAT
ATGGAGAATCATCTTAATTTATGCAATAATTAGAAGAAACTTGAATTATATTTAAGATAG
TAGATATAAAAATTCTAGAAAAGCAGAAAGAGTCCAATGATACATATATACATACAAATA
TATGCATATACGCGCACTCAAGTTCAATCACTCGTTCTATCAATAAATAATTCATTCAAC
AACCTATCTGACTATTATATTAAACTTATATAAAAGAATCTTTAAATCACCTTTGATTTA
AGCAACATAAATATATACTGTCATTTTTTAATTAGGATAACGCTTATTATTCTTTATTTT
TCGTATTCTCTACTTAACTTATATAATTACATACAATTACCTTTTTTTAATAAACGTTAA
ATTATTTTTTCAACTTCTTTTGTTAATACAGAGCCCTTTTGTTAAAAATTTTCAAAAAAA
GCCTAGTAAAACTCACAAAAACTACATCAAAAATTGCATTTTGTTAAATAATTTTAAAGC
TAAAACACCTATAGCGCAAAACAGACAACAAAATTTTATAATATACATATTTCATAAATT
TGTGACCTATATAAATCTCTATTAATATTTAGAAACAACTAGAAAATGGAATAAATTATT
TAGTGA


>TTHERM_000550712(protein)
MTTAAKRRLLRDFKKLQDDPPNGLTATPMEDNIMNWDAVIFGPEDTPWEGATFRLTLEFT
EDYPNKPPTVRFKTTIFHPNMENHLNLCNNQKKLELYLRQQIQKFQKSRKSPMIHIYIQI
YAYTRTQVQSLVLSINNSFNNLSDYYIKLIQKNLQITFDLSNINIYCHFLIRITLIILYF
SYSLLNLYNYIQLPFFNKRQIIFSTSFVNTEPFCQKFSKKAQQNSQKLHQKLHFVKQFQS
QNTYSAKQTTKFYNIHISQICDLYKSLLIFRNNQKMEQIIQ


>TTHERM_000550712(gene)
ATGACAACAGCTGCTAAGAGAAGATTACTTAGAGATTTCAAGAAATTGCAAGATGATCCA
CCAAATGGATTAACTGCTACTCCTATGGAAGATAATATAATGAACTGGGATGCAGTAATT
TTTGGTCCAGAAGACACACCTTGGGAAGGTGCAACATTCAGATTAACATTAGAGTTCACT
GAGGATTATCCCAATAAGCCACCTACTGTTAGATTTAAAACTACCATATTCCACCCTAAT
GTATACAACGATGGATCTATATGTTTAGACATTCTTTAAAACTAATGGAGTCCTATTTAC
GATGTTTGGGCCATCCTCACATCTATACGTTCACTTCTTTGTGATCCAAATCCAAATAGT
CCTGCCAATAGCGAAGCAGCCAAATTGTATTAAGAAGATCGCAAAGAATATATTCGTAGA
GTAAAGGAAATAGTAGAAATGAGCTGGAATTACTGATTAGATGGAGAATCATCTTAATTT
ATGCAATAATTAGAAGAAACTTGAATTATATTTAAGATAGTAGATATAAAAATTCTAGAA
AAGCAGAAAGAGTCCAATGATACATATATACATACAAATATATGCATATACGCGCACTCA
AGTTCAATCACTCGTTCTATCAATAAATAATTCATTCAACAACCTATCTGACTATTATAT
TAAACTTATATAAAAGAATCTTTAAATCACCTTTGATTTAAGCAACATAAATATATACTG
TCATTTTTTAATTAGGATAACGCTTATTATTCTTTATTTTTCGTATTCTCTACTTAACTT
ATATAATTACATACAATTACCTTTTTTTAATAAACGTTAAATTATTTTTTCAACTTCTTT
TGTTAATACAGAGCCCTTTTGTTAAAAATTTTCAAAAAAAGCCTAGTAAAACTCACAAAA
ACTACATCAAAAATTGCATTTTGTTAAATAATTTTAAAGCTAAAACACCTATAGCGCAAA
ACAGACAACAAAATTTTATAATATACATATTTCATAAATTTGTGACCTATATAAATCTCT
ATTAATATTTAGAAACAACTAGAAAATGGAATAAATTATTTAGTGA