Identifiers and Description

Gene Model Identifier

TTHERM_00584550

Standard Name

UBA5 (ubiquitin-activating enzyme 5)

Aliases

PreTt04063 | 80.m00109 | 3675.m00007

Description

ThiF family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00899 ) ThiF family
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( TIGR00179 ) UDP-N-acetylenolpyruvoylglucosamine reductase
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF
  • ( PF00107 ) oxidoreductase, zinc-binding dehydrogenase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 27.4%

TetraMine Data

TTHERM_00584550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15247.19.997093137033517e-262ThiF family protein (460 aa)
SGDYKL027W4.997966074691795e-65YKL027W Protein of unknown fun
ction, localized to the mitoch
ondrial outer membrane
DictyBaseDDB_G02684966.001055639413166e-58DDB_G0268496 on chromosome: 1
position 554652 to 556085
Stentor CoeruleusSteCoe_286172.9374821117108028e-30
WormBaseWBGene000183570.00000000000020009182674645818locus:moc-3 Adenylyltransfer
ase and sulfurtransferase MOCS
3 status:Confirmed UniProt
:O44510 protein_id:CCD61405.
1
OxytrichaContig20101.0.g960.00000000006996681903814525ThiF family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00584550(coding)
ATGTCTGAAAAAATAACTTATTCTATACTAGGCTTAGGTGCTGGTTTGCTAATAGGATTG
CAAGCAAGCAAATTGCTCAACAAGAAAGCCAATGATGAAATAGATATTGATAAGCTAAAA
GAAAAAAAGAAATAGTAGAAGATAGAGATTCAAGAAAGTAATCAGAAACACTTAAACAAC
TTTTCTTCTCAAGAATATTAAAATATGATGAAGGAATAATTAGTCAGAAATATTTAATTT
TTTGGTGAAGAAGGATAAAAAAAAATATAGGATAGTTACATAATAATATTTGGAGTTGGA
GGAGTCGGTTCTCACGTAGCTGCATCTTTGGCTCGTTCTGGAGTAGCACATTTAAAAATA
GTTGATTTTGATTAAGTATCTTTATCTTCCCTTAACAGACATGCTTTTGCAACTCATGCA
GATGTTGGACGCTCTAAATGTGAATGCGTTAAAGATTACATTAAAAGAATAGTTCCTCAT
ACTAGAGTTGATATAGTTGAAGATTATGTTACTAAAAATAATGTTGAAACCTTTTTCAAA
GACTTAGCCGAAGATGGTAAAACCATAATAAAACCAACTTATGTGGTTGATTGCATTGAT
AATATCGATGCTAAGGTATCTCTTTTAGCATATTGTAAATTAAATGGCATTAAGGTAATT
TCATCTATGGGAGCTGGAATGAAGGCTGATCCCACCAGAATTCAAATCAGAGATATTTCT
GAAACTAATTATGATGACTTATCAAGAGCAGTTCGTACTAAACTAAAAAAATATAAAGTA
CATGATGGGATTAAAGTAGTTCTTAGCGTTGAGCGTAGTGAGAGAGAATTATTACCTTTA
AAGGAACACCAAGAAAGCAATCCAGATGAATATAAAGTATTTTCAAACTACAGATTACGT
ATTGTTCCTGTTTTAGGAACTATGCCTGCTTTAGTTGCATATTCTTTAAGTTCGTATGTG
CTCTGTGATTTAGCTGGTTAACTTTACAAGCCCTTCTTAATCGATGAAGTGAAACAAGCA
AATTATGCAAAACTTTTTAATCATTTGTAATAAGAAGCTCGTAAAATTGGAATATCATAT
GAAGATCTTGAGTTTGATATGGAGGATATCTATATAGTTGCAAGAGAAGTTTATGATTGG
AAAGAAGTTGTCACTGATAAAAAGGTTTGTGGAGGATTAGTAGTACGTTGGAATCCTGAA
TTGCCATTTAAGCCAGAAAATTTTGTTTTATTAAACTATTAAGATGCTAAAAAGCATTGT
ACTTTCACCAAATTTACAGAAGTATAAGAGGCTTATCCTAAAGAAATCTTATAAAAAGTA
GAAGAAAAGCAGTAAATCTACAGAAACTTTATTTCAAAAAAGCCTATTTTGTATAAATGA


>TTHERM_00584550(protein)
MSEKITYSILGLGAGLLIGLQASKLLNKKANDEIDIDKLKEKKKQQKIEIQESNQKHLNN
FSSQEYQNMMKEQLVRNIQFFGEEGQKKIQDSYIIIFGVGGVGSHVAASLARSGVAHLKI
VDFDQVSLSSLNRHAFATHADVGRSKCECVKDYIKRIVPHTRVDIVEDYVTKNNVETFFK
DLAEDGKTIIKPTYVVDCIDNIDAKVSLLAYCKLNGIKVISSMGAGMKADPTRIQIRDIS
ETNYDDLSRAVRTKLKKYKVHDGIKVVLSVERSERELLPLKEHQESNPDEYKVFSNYRLR
IVPVLGTMPALVAYSLSSYVLCDLAGQLYKPFLIDEVKQANYAKLFNHLQQEARKIGISY
EDLEFDMEDIYIVAREVYDWKEVVTDKKVCGGLVVRWNPELPFKPENFVLLNYQDAKKHC
TFTKFTEVQEAYPKEILQKVEEKQQIYRNFISKKPILYK


>TTHERM_00584550(gene)
ATGTCTGAAAAAATAACTTATTCTATACTAGGCTTAGGTGCTGGTTTGCTAATAGGATTG
CAAGCAAGCAAATTGCTCAACAAGAAAGCCAATGATGAAATAGATATTGATAAGCTAAAA
GAAAAAAAGAAATAGTAGAAGATAGAGATTCAAGAAAGTAATCAGAAACACTTAAACAAC
TTTTCTTCTCAAGAATATTAAAATATGATGAAGGAATAATTAGTCAGAAATATTTAATTT
TTTGGTGAAGAAGGATAAAAAAAAATATAGGATAGTTACATAATAATATTTGGAGTTGGA
GGAGTCGGTTCTCACGTAGCTGCATCTTTGGCTCGTTCTGGAGTAGCACATTTAAAAATA
GTTGATTTTGATTAAGTATCTTTATCTTCCCTTAACAGACATGCTTTTGCAACTCATGCA
GATGTTGGACGCTCTAAATGTGAATGCGTTAAAGATTACATTAAAAGAATAGTTCCTCAT
ACTAGAGTTGATATAGTTGAAGATTATGTTACTAAAAATAATGTTGAAACCTTTTTCAAA
GACTTAGCCGAAGATGGTAAAACCATAATAAAACCAACTTATGTGGTTGATTGCATTGAT
AATATCGATGCTAAGGTATCTCTTTTAGCATATTGTAAATTAAATGGCATTAAGGTAATT
TCATCTATGGGAGCTGGAATGAAGGCTGATCCCACCAGAATTCAAATCAGAGATATTTCT
GAAACTAATTATGATGACTTATCAAGAGCAGTTCGTACTAAACTAAAAAAATATAAAGTA
CATGATGGGATTAAAGTAGTTCTTAGCGTTGAGCGTAGTGAGAGAGAATTATTACCTTTA
AAGGAACACCAAGAAAGCAATCCAGATGAATATAAAGTATTTTCAAACTACAGATTACGT
ATTGTTCCTGTTTTAGGAACTATGCCTGCTTTAGTTGCATATTCTTTAAGTTCGTATGTG
CTCTGTGATTTAGCTGGTTAACTTTACAAGCCCTTCTTAATCGATGAAGTGAAACAAGCA
AATTATGCAAAACTTTTTAATCATTTGTAATAAGAAGCTCGTAAAATTGGAATATCATAT
GAAGATCTTGAGTTTGATATGGAGGATATCTATATAGTTGCAAGAGAAGTTTATGATTGG
AAAGAAGTTGTCACTGATAAAAAGGTTTGTGGAGGATTAGTAGTACGTTGGAATCCTGAA
TTGCCATTTAAGCCAGAAAATTTTGTTTTATTAAACTATTAAGATGCTAAAAAGCATTGT
ACTTTCACCAAATTTACAGAAGTATAAGAGGCTTATCCTAAAGAAATCTTATAAAAAGTA
GAAGAAAAGCAGTAAATCTACAGAAACTTTATTTCAAAAAAGCCTATTTTGTATAAATGA