Identifiers and Description

Gene Model Identifier

TTHERM_00554610

Standard Name

UBA4 (ubiquitin-activating enzyme)

Aliases

PreTt29268 | 72.m00191

Description

ubiquitin-activating enzyme (UBA4 ortholog)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00899 ) ThiF family
  • ( PF05237 ) MoeZ/MoeB domain
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00554610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07308.19.997093137033517e-262ThiF family protein (384 aa)
OxytrichaContig3977.0.g986.000794656677251e-128ThiF family
DictyBaseDDB_G02933062.0004683842646898e-122uba5 on chromosome: 6 position
2741328 to 2742563
WormBaseWBGene000201849.997006461365152e-115locus:uba-5 Ubiquitin-like m
odifier-activating enzyme 5
status:Confirmed UniProt:P91
430 protein_id:CCD67786.1
Stentor CoeruleusSteCoe_56011.0377033238158346e-53
SGDYDR390C0.00000000000003999587784428659UBA2 Subunit of a heterodimeri
c nuclear SUMO activating enzy
me (E1) with Aos1p; activates
Smt3p (SUMO) before its conjug
ation to proteins (sumoylation
), which may play a role in pr
otein targeting; essential for
viability

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000213
  2. Ref:SUPR000188
  3. Ref:SUPR000171

Sequences

>TTHERM_00554610(coding)
ATGGATAGCGATAAAGAACTACAAAGGCTTTTAGATGAAAGATAAAAGCTAAATGATAAA
ATTAACGAATATGTTAAAGAAAAGTATTAAAAGTATAAAGGTATGAGCGAAGAGGTCAAG
GATGATAACCCATATAGTCGTTTGATGGCATTGAAGAGAATGGGTGTTGTTTAAAATTAC
GAGAAAATTAGAGATTGTTCAGTTTTAGTTGTTGGTGTTGGTGGTGTAGGTTCAGTATTA
GCTGAAATGCTTACTCGTTGTGGCTTAGGCAAATTGATTATCTACGATTATGATAAAGTA
GAGTTAGCAAACATGAATAGATTGTTTTATACTCCTTAATAAGTTGGTTTATCTAAGGTC
GATGCAGCTAAAGGGACTCTTTAATCTATAAATCCTGAAATTACAATCGAAGCTTACAAC
ATGAACATTACCACTAACAGTGGATTTGAGCACTTGTTAGATAGAATAAAGAAAGGAGGT
AAGAATGGCGAAAGAATTAATTTAGTAGTTTCTTGTGTAGATAACTATGCTGCTCGTATG
GCAATTAATACAGGTTGTAACGAACTTGACCAAATATGGTTTGAAAGTGGTGTAAGTGAA
GATGCTATGAGTGCTCATATTTAGATTATGATTCCAGGTGAAACTGCTTGCTTCGCATGT
GCTACACCTCTTGCTGTGGTTGAAAGTAACGAACACACAATAAAAAGAGAAGGCGTTTGT
GCAGCTTCACTTCCTACTACTATGGGTATTACAGCTGGTTTTCTTGCATAAAATGCCTTA
AAATTCCTTCTTGATTTTGGTGACCTTGCTTTTGTTTTAGCTTATAACGCAAAAGCTGAC
TTTTTCACCAACTATATGATTAAGCCAAACTCTGAATGCAAGGAAAACGAATGTAGAAAA
AGACAAGCTGAAAAGGCTGTTAATAAATAAGAAAACATCCTTGAAAGACTTGAATAAAGA
AAGAAGGCTGCCAAGGAAGCCTTCGAAAAGGAAAATAAACCCAGCGAAAACGAGTGGGGA
ATCGAAATAGTTGATGAATCAGGACCACAAAGTGATTCCAATAAAAAAGATGATGATGTA
AAGGAAATTTCAGAATAAGAAATTGAGCAAAATAATTTGGACGATTTGATGGCAAAACTG
TAAAATATGTGA


>TTHERM_00554610(protein)
MDSDKELQRLLDERQKLNDKINEYVKEKYQKYKGMSEEVKDDNPYSRLMALKRMGVVQNY
EKIRDCSVLVVGVGGVGSVLAEMLTRCGLGKLIIYDYDKVELANMNRLFYTPQQVGLSKV
DAAKGTLQSINPEITIEAYNMNITTNSGFEHLLDRIKKGGKNGERINLVVSCVDNYAARM
AINTGCNELDQIWFESGVSEDAMSAHIQIMIPGETACFACATPLAVVESNEHTIKREGVC
AASLPTTMGITAGFLAQNALKFLLDFGDLAFVLAYNAKADFFTNYMIKPNSECKENECRK
RQAEKAVNKQENILERLEQRKKAAKEAFEKENKPSENEWGIEIVDESGPQSDSNKKDDDV
KEISEQEIEQNNLDDLMAKLQNM


>TTHERM_00554610(gene)
ATGGATAGCGATAAAGAACTACAAAGGCTTTTAGATGAAAGATAAAAGCTAAATGATAAA
ATTAACGAATATGTTAAAGAAAAGTATTAAAAGTATAAAGGTATGAGCGAAGAGGTCAAG
GATGATAACCCATATAGGTACTTAGTTAGATACATGAATAAATAAATACATAAATCATAT
CATACATAATATAAATTAAAAGATTAAAAATTGAAATATTTTAACAAATAAACTGAGCAA
TTAAATTAATTAAATTGTTAAAATATAAAATTTATAAGTAAACGCATTATAGAAAATAGT
TCATTTTTATTAAGTTTTTAAGCGATTAGAAATATTTCACTTTCTTCTGTTTTTTATAGA
GAGCAATTACTTTTTTATTTGATAGATTTTAATGGATGAGTAATTAAGCAATTATTTAAT
TTATTTAGTCGTTTGATGGCATTGAAGAGAATGGGTGTTGTTTAAAATTACGAGAAAATT
AGAGATTGTTCAGTTTTAGTTGTTGGTGTTGGTGGTGTAGGTTCAGTATTAGCTGAAATG
CTTACTCGTTGTGGCTTAGGCAAATTGATTATCTACGATTATGATAAAGTAGAGTTAGCA
AACATGAATAGGTAAATAAATAAATCAATTTAAAAATTATTAAAAATGCATAAAATTTTG
TTATAGATTTATAAGAATAAGCATAAAAAAGTTAGAATTTATTTCATATACTTATATCAA
TAGATGATAAAGTAAAAATATAAACATAAATACAGAATAAAATCATAATTTTAAATTATG
TTAAGAAATATTTTTTTTGTTTATCTGTAAAATGTTCAAAAAATTAATAAATTATTAGAT
TAGTTTATATTAATTTTTATTTTAAAAGATTGTTTTATACTCCTTAATAAGTTGGTTTAT
CTAAGGTCGATGCAGCTAAAGGGACTCTTTAATCTATAAATCCTGAAATTACAATCGAAG
CTTACAACATGAACATTACCACTAACAGTAATATATTTTCTTTAAGCTTTTAGATTACTA
TCATCATAATTAAAAAACAGTTAAAATATCAAGATCTTAACATAAAGATATTATTTGTTA
GAAAAATTAATATACTAATAAATAGAAATATAAATAATTTATAAAGATTGTGATCAAAAA
TTAAATTCTATCTAACAATGATAATAAATAAATAAATAAATAAATAAATAAAGCAATTTT
TTATGTATTCATTTTAAATTTATTTAAGAGACTAATTGGAAAGCAAATATTTAAATAGTT
TTCATTTAAACATAAAGGTGGATTTGAGCACTTGTTAGATAGAATAAAGAAAGGAGGTAA
GAATGGCGAAAGAATTAATTTAGTAGTTTCTTGTGTAGATAACTATGCTGCTCGTATGGC
AATTAATACAGGTTGTAACGAACTTGACCAAATATGGTAATTATTTTATATTGATTTTGT
TTTAAAAAAAATGGGAAGTTAAATTTATGAATAAAAAAGTTTTATTAATTAAAAAATAAA
TTGATTTAATCAATCAAGTTAGATCATTATAAAAGCAAAAAATATATTAATAGAAACAAT
TTTGATTTTAGAATAAATAAGGTCTGTAAAAATTAAATAGAAAAAAAATTATGTCAAAAA
TAAGAAGAAAAAAAAAAATCTTTATTATTCTTGAAGACAGATTTAAATTTATTAATTTAG
AATAAATAAATAATCTAAGAGTATGCGTCACTCACTTTTAATAATCAACCATTTTAAATT
TTTATAACAATATTATTATGCAATATTGTTTAATTTATTTGGATCGTCTATTATAAATTA
CAATAGATTTTACGTCATACTTTATAATAAAAATTAACCATTTTTTTATTATTTAAGTTT
TTTAAATTTATAATATAATTCTATCTTGTTGATAACTTTTTGGTGCTCCTTAAAAGATTT
TCAAAAATTTGATTCATTTTTTCAAAAATAAAAATTCATCATCTAAAAACCAAAAATTAT
AATAAAAATTTATTCTATAAAATGTAAGAATATTCTATTTAAAATTTCAAAATCAAACCA
ATAAATATTACAACTTTTGTAGTTTTATAATATGATCTAGCACAATAAACAGCTTATTTG
CATTTTTATTGATACAATTTTTAGAATGCATCAATAAAAAGTTTTATTTCCCCTTTTAGA
TTTTCAAAAAAATGTAAAGCTTCAAAGAAAAAAAATATGATTTTTTAACAAGTTATTGTA
ACATGATATTTTATTGCGTAACAAATTAGTATTGAGTCATTTATCAATCAATTTATTTTT
AAAACTGCCTTTACCCCCTCGTTTGTGAATTAATTTATAGGAGAAGATAGCCTTATAATT
TTTGCTTGTAACCTAACTCTAACTTTAAGATATTTTTTATTATGTATTTTTCAGGTTTGA
AAGTGGTGTAAGTGAAGATGCTATGAGTGCTCATATTTAGATTATGATTCCAGGTGAAAC
TGCTTGCTTCGCATGTGCTACACCTCTTGCTGTGGTTGAAAGTAACGAACACACAATAAA
AAGAGAAGGCGTTTGTGCAGCTTCACTTCCTACTACTATGGGTATTACAGCTGGTTTTCT
TGCATAAAATGCCTTAAAATTCCTTCTTGATTTTGGTGACCTTGCTTTTGTTTTAGCTTA
TAACGCAAAAGCTGACTTTTTCACCAACTATATGATTAAGCCAAACTCTGAATGCAAGGA
AAACGAATGTAGAAAAAGACAAGCTGAAAAGGCTGTTAATAAATAAGAAAACATCCTTGA
AAGACTTGAATAAAGAAAGAAGGCTGCCAAGGAAGCCTTCGAAAAGGAAAATAAACCCAG
CGAAAACGAGTGGGGAATCGAAATAGTTGATGAATCAGGACCACAAAGTGATTCCAATAA
AAAAGATGATGATGTAAAGGAAATTTCAGAATAAGAAATTGAGCAAAATAATTTGGACGA
TTTGATGGCAAAACTGTAAAATATGTGA