Identifiers and Description

Gene Model Identifier

TTHERM_00092840

Standard Name

UBA22 (UBA2 Paralog)

Aliases

PreTt16538 | 6.m00612 | 3836.m02198

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00899 ) ThiF family
  • ( PF05237 ) MoeZ/MoeB domain
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( PF02134 ) Repeat in ubiquitin-activating (UBA) protein
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF
  • ( TIGR00136 ) tRNA uridine 5-carboxymethylaminomethyl modification enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00092840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02543.19.997093137033517e-262hypothetical protein (578 aa)
OxytrichaContig20101.0.g962.998830401637127e-79ThiF family
DictyBaseDDB_G02869193.999627495270728e-67uba2 on chromosome: 4 position
5077667 to 5079750
WormBaseWBGene000067001.0000310450948521e-65locus:uba-2 SUMO-activating
enzyme subunit uba-2 status:
Partially_confirmed UniProt:
Q9NAN1 protein_id:CAB54319.4
SGDYDR390C1.0003503620230312e-57UBA2 Subunit of a heterodimeri
c nuclear SUMO activating enzy
me (E1) with Aos1p; activates
Smt3p (SUMO) before its conjug
ation to proteins (sumoylation
), which may play a role in pr
otein targeting; essential for
viability
Stentor CoeruleusSteCoe_199930.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000183
  2. Ref:SUPR000161

Sequences

>TTHERM_00092840(coding)
ATGGAAATAGAGGCTTAAAGGTCTGACAGAAGCTTGAAGCTAATTTATGGTGAAGAAGTT
TACAATAAAATTATCTAATCAAATGTTTTAATTGGAGGAGCAGGTGGTGTTGGATGTGAA
ATAATTAAATCATTAAGTAAAACAGGATTTAGGAAATTTACAATGATCGATTTAGATACA
ATAGAGCTAACCAATTTAAATAGGCAATTCTATTTCAGAAAACATCATGTAGGAAAAGCT
AAATCTGCTTGCGCTAAAGAAGGAGTACTATTAATTGAACCAAATATCTTGTAAGTAGAT
GCTATTTTAGGAAATATTTATGATCCAAAGTTTGATGATTTATTTTATAAATAATTTGAT
ATTGCATTTTGTGCTTTTGATAACTAAGGAGCTAGAAGGCACTTTGGTAAGATGTGTACA
GTGAATAACATTCCTATGGTAGAGGCTGGAACTTCTGCATTTAATGGATAGACATAGACT
AGAATAAAAGATTTATTTGAATGCAGAAATTGCACTCCAGAAGTCAAACAATAAACTAGC
TTTAATGTTTGCTCAATTAGAACTAGACCTTCTGAACCTATTCACTGCATAGTTTGGGCT
TCTAATATGTTTAATTTGATATTTGGGAACCAAGATGATTCAAATTTGTTGGAAAACTAT
ATTTAAGATATTTTCAAAGAGGGAATCAAGAATGTCTAAGACCCAAAAGAAAAAGCTCTT
CAGTTATTTGAAAAGATTTTCAACGAAGACATTTAAAAATGTGATGAAAAAGAAAGATTC
CCAATTTCTTTTGAGCAATCTTTATAAATTGACAACAAAGAAGATGCTGTTTACTTTGAT
GAAAGAAATAATCGCAAATTGTTAGAAGACGAAAAAATCTTCACTATTAAGGAGTATGCA
CAGAAATTTATTTAAGCGTTTTTAGATGTATTTCATCATAGAAAAGAAGCTTTAGGAGAA
CTAAAATTTGATAAAGATGATTAACTGGCTTTGAAATTTGTCGCTGCAATCACTAATTTG
CGTACATTTAATTTCCTTAATAAGGAAAATGAAAAGAATAAGTTGAGATATCTCTCAGAG
CATAAAATAAAATAAATGGTTGGAAATATTATCCCTGCAATAGCATCAACAAACGCTATC
GTTTCTGCTATCCAAGTAAATGAAGCAATTAAAATAATGAAAGGTTATGCCAAAACTAAG
CCTTAACTATTCAGCGAGTATTTAGTCCAAAATGGTGATCAAAGCAAAATAACTCCAGCA
CAGTTATCTCTTCCACAATTATCTTGTCCTGTTTGCTCTCCAGCTAATTGCTACATAAAC
ATAAAAGCAAATTGCACTCAAATAACTTTTGGATAGCTCAAATAAATTTTTGAAGAATAG
TACTTAGCATATAATTAAATTATCAAAATAGATGATAAAGTATATTATGACCCTCATTAG
ATTAGTTTGAGAAAGATATTTGACAACTTACTACTAAAGAAAATTAGCGAACTTCCAAAT
TATAATTAAGACTACACTAAATTTAAGCTATTTAGCATTGATAATTAGATCACTTGGGAG
TTCAATTTAATGCATGATAGCTCTTTATAAGGATAACAAGTAGTTTGTGATCAAAATAGT
GACCCTACTAGAATAAAGTAGCAACAAATTCAATATATAAAACTAAAGCATGAGCAAACT
TTTAAAGAAAAAATAGATATATTTAAGAGATATAAGTATATTTGA


>TTHERM_00092840(protein)
MEIEAQRSDRSLKLIYGEEVYNKIIQSNVLIGGAGGVGCEIIKSLSKTGFRKFTMIDLDT
IELTNLNRQFYFRKHHVGKAKSACAKEGVLLIEPNILQVDAILGNIYDPKFDDLFYKQFD
IAFCAFDNQGARRHFGKMCTVNNIPMVEAGTSAFNGQTQTRIKDLFECRNCTPEVKQQTS
FNVCSIRTRPSEPIHCIVWASNMFNLIFGNQDDSNLLENYIQDIFKEGIKNVQDPKEKAL
QLFEKIFNEDIQKCDEKERFPISFEQSLQIDNKEDAVYFDERNNRKLLEDEKIFTIKEYA
QKFIQAFLDVFHHRKEALGELKFDKDDQLALKFVAAITNLRTFNFLNKENEKNKLRYLSE
HKIKQMVGNIIPAIASTNAIVSAIQVNEAIKIMKGYAKTKPQLFSEYLVQNGDQSKITPA
QLSLPQLSCPVCSPANCYINIKANCTQITFGQLKQIFEEQYLAYNQIIKIDDKVYYDPHQ
ISLRKIFDNLLLKKISELPNYNQDYTKFKLFSIDNQITWEFNLMHDSSLQGQQVVCDQNS
DPTRIKQQQIQYIKLKHEQTFKEKIDIFKRYKYI


>TTHERM_00092840(gene)
ATGGAAATAGAGGCTTAAAGGTCTGACAGAAGCTTGAAGCTAATTTATGGTGAAGAAGTT
TACAATAAAATTATCTAATCAAATGTTTTAATTGGAGGAGCAGGTGGTGTTGGATGTGAA
ATAATTAAATCATTAAGTAAAACAGGATTTAGGAAATTTACAATGATCGATTTAGATACA
ATAGAGCTAACCAATTTAAATAGGCAATTCTATTTCAGAAAACATCATGTAGGAAAAGCT
AAATCTGCTTGCGCTAAAGAAGGAGTACTATTAATTGAACCAAATATCTTGTAAGTAGAT
GCTATTTTAGGAAATATTTATGATCCAAAGTTTGATGATTTATTTTATAAATAATTTGAT
ATTGCATTTTGTGCTTTTGATAACTAAGGAGCTAGAAGGCACTTTGGTAAGATGTGTACA
GTGAATAACATTCCTATGGTAGAGGCTGGAACTTCTGCATTTAATGGTAATAATTAATTT
TAACAATAAATTGAAAATTATTGTATTTTTCAAAGTCTACTCAATATTTTAACCCTTAAA
AATTTAAAGAATATATTTTTCAAGTAAATTAGGAGTAAAATATAATTTTATTGCTTTGAA
AATTTCAAATAAAATAAGAATTTTAATGTTTTAAAAAATTTATTCAAACAGGATAGACAT
AGACTAGAATAAAAGATTTATTTGAATGCAGAAATTGCACTCCAGAAGTCAAACAATAAA
CTAGCTTTAATGTTTGCTCAATTAGAACTAGACCTTCTGAACCTATTCACTGCATAGTTT
GGGCTTCTAATATGTTTAATTTGATATTTGGGAACCAAGATGATTCAAATTTGTTGGAAA
ACTATATTTAAGATATTTTCAAAGAGGGAATCAAGAATGTCTAAGACCCAAAAGAAAAAG
CTCTTCAGTTATTTGAAAAGATTTTCAACGAAGACATTTAAAAATGTGATGAAAAAGAAA
GATTCCCAATTTCTTTTGAGCAATCTTTATAAATTGACAACAAAGAAGATGCTGTTTACT
TTGATGAAAGAAATAATCGCAAATTGTTAGAAGACGAAAAAATCTTCACTATTAAGGAGT
ATGCACAGAAATTTATTTAAGCGTTTTTAGATGTATTTCATCATAGAAAAGAAGCTTTAG
GAGAACTAAAATTTGATAAAGATGATTAACTGGCTTTGAAATTTGTCGCTGCAATCACTA
ATTTGCGTACATTTAATTTCCTTAATAAGGAAAATGAAAAGAATAAGTTGAGATATCTCT
CAGAGCATAAAATAAAATAAATGGTTGGAAATATTATCCCTGCAATAGGTATTTATTTAA
TTTAAAAATATAAATAAATTATTAAATATCAATTAAACTATAGCATCAACAAACGCTATC
GTTTCTGCTATCCAAGTAAATGAAGCAATTAAAATAATGAAAGGTTATGCCAAAACTAAG
CCTTAACTATTCAGCGAGTATTTAGTCCAAAATGGTGATCAAAGCAAAATAACTCCAGCA
CAGTTATCTGTAAATTATCCATATTAAATAAGCACATTTTTTTAAACTATAAATTTAATT
TAAAAGCTTCCACAATTATCTTGTCCTGTTTGCTCTCCAGCTAATTGCTACATAAACATA
AAAGCAAATTGCACTCAAATAACTTTTGGATAGCTCAAATAAATTTTTGAAGAATAGTAC
TTAGCATATAATTAAATTATCAAAATAGATGATAAAGTATATTATGACCCTCATTAGATT
AGTTTGAGAAAGATATTTGACAACTTACTACTAAAGAAAATTAGCGAACTTCCAAATTAT
AATTAAGACTACACTAAATTTAAGCTATTTAGCATTGATAATTAGATCACTTGGGAGTTC
AATTTAATGCATGATAGCTCTTTATAAGGATAACAAGTAGTTTGTGATCAAAATAGTGAC
CCTACTAGAATAAAGTAGCAACAAATTCAATATATAAAACTAAAGCATGAGCAAACTTTT
AAAGAAAAAATAGATATATTTAAGAGATATAAGTATATTTGA