Identifiers and Description

Gene Model Identifier

TTHERM_00391590

Standard Name

UBA2 (Ubiquitin Activating enzyme 2 )

Aliases

PreTt23486 | 42.m00220 | 3813.m01445

Description

Ubiquitin activating enzyme

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00391590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11464.19.997093137033517e-262ubiquitin-activating enzyme e1
(684 aa)
OxytrichaContig20101.0.g964.0006908853687255e-76ThiF family
DictyBaseDDB_G02869191.9999590304423412e-72uba2 on chromosome: 4 position
5077667 to 5079750
WormBaseWBGene000067004.000989088096131e-71locus:uba-2 SUMO-activating
enzyme subunit uba-2 status:
Partially_confirmed UniProt:
Q9NAN1 protein_id:CAB54319.4
SGDYDR390C6.9972728945133496e-59UBA2 Subunit of a heterodimeri
c nuclear SUMO activating enzy
me (E1) with Aos1p; activates
Smt3p (SUMO) before its conjug
ation to proteins (sumoylation
), which may play a role in pr
otein targeting; essential for
viability
Stentor CoeruleusSteCoe_199930.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25527524: Nasir AM, Yang Q, Chalker DL, Forney JD (2015) SUMOylation is developmentally regulated and required for cell pairing during conjugation in Tetrahymena thermophila. Eukaryotic cell 14(2):170-81
  2. Ref:16682458: Matsuda A, Forney JD (2006) The SUMO pathway is developmentally regulated and required for programmed DNA elimination in Paramecium tetraurelia. Eukaryotic cell 5(5):806-15

Sequences

>TTHERM_00391590(coding)
ATGAGTTTAGGAAGAATAAATCAGCTTTTATTTGGCAAGGAATTTTTAAACTATTTAAAT
GAAATAAACATTCTTCTTATTGGTGTAGGAGGCATTGGTTGCGAAGTTTTAAAAGTGTTG
TAATAGTTTAAAGTGAAGTCTTTACATATTTTGGATTTAGATACAATTGAAGTTTCAAAT
CTCAATCGTCAGTTTTTGTTTCGTAAACATCACAGAGGACATTTTAAAGCACACGTAGCT
AGAGATGTTTTGAAGCAAGAATATCCTGATATGAATATTATTTCATATAACAGCAATATT
AAGGATGCTTAATTTGGGTTAAAGTTCTTTAAAAACTTCTAGCTTGTCATTATGGCTCTT
GATAATTAAGAAACCAGGTCTTTTGTAAACAAATAATGCATGATATTGAATATTCCTTTG
ATAGATGCAGGAACAACTGGATATAAAGGATAGAGCTTTATATTGAAGAGAGGAGAGACT
AGATGCTACGACTGCTTCCCTAGATCTGAAAATAAGAAAACCTACCCTGCTTGCACTATC
AGAACTCTTCCTGAGAAGCCAGTTCACTGCATCATCTGGGCTAAATATCTTTACACTGTA
CTTTTTAATGAGAAATTAGAAGATGACGATGATTCCAACCTTCTTTAGGATATTGCTAAA
TACATTGAAGGAGAAAACCATACCGACCTTGAGAAAGGACAATACCTTTTTAAGGCTATA
TTTGAAACTGATGTTAATAGGTAGAAGGAAGGAGAAGATAATTAAAAATTTTAGCATTTG
AAAGTGCTAGTTAGAGAGGAGTTAGAGGGTAAGTTAGATAAATCTCAAGATTATTTGCAT
AGATAAGACTTAAAATTCTTGCAAAGCACCCATACTGAAGAAGTTTATATGGATATTTTT
ATTAAGAGCTTTGAGCATTTGATCAAGGAAAAAAGATAAAAAAGTTGTGTTCCCTTTGAA
AAAGATGACAATTTGTGTATGAAGTTTATTACTGCTGCATGTAATTTACGTTGCATAGTT
TTTTCCATTCCTCTCTAAACTTAATTTTAGGTTAAGGAAGTTGCTGGTAATATTGTGCCT
GCTATTGCAAGCACTAATTCAATAGTAAGTGCTATTGAAATTACTGAAACTATTAAATTA
TTATAAAGACAGTTTTACAACAACCCTTAAAAATACAAAAATAGAGAATTATACATTTAA
AATGACATTAAAACTAAAATCCTTGATGCAAAACCTGGTAACTTCAATCCTAATTGCATG
TCTTGCAACTAGAATTTGCTTCCTCATATTATTTATTGTGATTTTAACAAAGTCACTCTT
GGAGAGTTTATTAATTCTGAGCTTCGTAGCAAAGCTATGTAGGATGAAGATGATGATGAG
GGAAACGATGATAATAAATTAGTTAACTTTAGTATTTCAAGTGGTTAATTTATTATATAT
GAAGAGGATGAGTATCAAGAAGAAGATGAATAAGAGCAAAACGAAGCAAAGCGCCAAAAA
TTAATCAGTGAAATATTCAAAGACTTTTCTGATAGTAGAGTTGTAGTTACAAATGAGGAT
AACAACAGCATCCATTAAACTTATCTCTTCTGTCATATCGAGAACCACAAAATCCCTGGT
CTTGACATAGTTCGCTAAGAAAAGAATCCTAACAATACAGTCACATGGAAAACAGTGATT
GCTTAATCAGACACTGTAAACAAAGATGAGGAATAAAAAAAGCAAGAAGAAGAAGAACAA
AATAAAAAGAACTATAAGGAAGTTAAAGGAGATGACAAAAACAATAACACTTTAGAAATA
TTAGATTCCGATTCAGAAGATGATTTAGTTATTTGCGAAGATAATGATAATCCATCTCAA
GGCGCCGCAGAAAAAGAAAAGAGTAAATAATCAAATGGAAAATAACCTCATTCTGAAACT
GATGTATCTTCTTTAAACCAAAAGAGAAAGGCAGTATAGGAAATTTCTGATGGTGGAGCT
ATGTAAATAATTGATGACAGTGATGATGAAATAATTTTTGAAGATTAATAAGACAACAAA
AAGTTAAAAGTGGATTGA


>TTHERM_00391590(protein)
MSLGRINQLLFGKEFLNYLNEINILLIGVGGIGCEVLKVLQQFKVKSLHILDLDTIEVSN
LNRQFLFRKHHRGHFKAHVARDVLKQEYPDMNIISYNSNIKDAQFGLKFFKNFQLVIMAL
DNQETRSFVNKQCMILNIPLIDAGTTGYKGQSFILKRGETRCYDCFPRSENKKTYPACTI
RTLPEKPVHCIIWAKYLYTVLFNEKLEDDDDSNLLQDIAKYIEGENHTDLEKGQYLFKAI
FETDVNRQKEGEDNQKFQHLKVLVREELEGKLDKSQDYLHRQDLKFLQSTHTEEVYMDIF
IKSFEHLIKEKRQKSCVPFEKDDNLCMKFITAACNLRCIVFSIPLQTQFQVKEVAGNIVP
AIASTNSIVSAIEITETIKLLQRQFYNNPQKYKNRELYIQNDIKTKILDAKPGNFNPNCM
SCNQNLLPHIIYCDFNKVTLGEFINSELRSKAMQDEDDDEGNDDNKLVNFSISSGQFIIY
EEDEYQEEDEQEQNEAKRQKLISEIFKDFSDSRVVVTNEDNNSIHQTYLFCHIENHKIPG
LDIVRQEKNPNNTVTWKTVIAQSDTVNKDEEQKKQEEEEQNKKNYKEVKGDDKNNNTLEI
LDSDSEDDLVICEDNDNPSQGAAEKEKSKQSNGKQPHSETDVSSLNQKRKAVQEISDGGA
MQIIDDSDDEIIFEDQQDNKKLKVD


>TTHERM_00391590(gene)
ATGAGTTTAGGAAGAATAAATCAGCTTTTATTTGGCAAGGAATTTTTAAACTATTTAAAT
GAAATAAACATTCTTCTTATTGGTGTAGGAGGCATTGGTTGCGAAGTTTTAAAAGTGTTG
TAATAGTTTAAAGTGAAGTCTTTACATATTTTGGATTTAGATACAATTGAAGTTTCAAAT
CTCAATCGTCAGTTTTTGTTTCGTAAACATCACAGAGGACATTTTAAAGTAATTGAAATT
TACTTTTGGGCGGATTAATAATTTATTCCTGAAAAATTATCTAGGCACACGTAGCTAGAG
ATGTTTTGAAGCAAGAATATCCTGATATGAATATTATTTCATATAACAGCAATATTAAGG
ATGCTTAATTTGGGTTAAAGTTCTTTAAAAACTTCTAGCTTGTCATTATGGCTCTTGATA
ATTAAGAAACCAGGTCTTTTGTAAACAAATAATGCATGATATTGAATATTCCTTTGATAG
ATGCAGGAACAACTGGATATAAAGGATAGAGCTTTATATTGAAGAGAGGAGAGACTAGAT
GCTACGACTGCTTCCCTAGATCTGAAAATAAGAAAACCTACCCTGCTTGCACTATCAGAA
CTCTTCCTGAGAAGCCAGTTCACTGCATCATCTGGGCTAAATATCTTTACACTGTACTTT
TTAATGAGAAATTAGAAGATGACGATGATTCCAACCTTCTTTAGGATATTGCTAAATACA
TTGAAGGAGAAAACCATACCGACCTTGAGAAAGGACAATACCTTTTTAAGGCTATATTTG
AAACTGATGTTAATAGGTAAAAAGATATCTTTTATAAAATAAAATCCAATATAAATTATT
AGAAGACACTTAAATTATACATTCAATCTTTAATTAATTAATTAATTAATTATTATATTT
TGTGTAGACAGAGATAGATAGAACTTTAATTTTTATCTTTTATTACAGGTAGAAGGAAGG
AGAAGATAATTAAAAATTTTAGCATTTGAAAGTGCTAGTTAGAGAGGAGTTAGAGGGTAA
GTTAGATAAATCTCAAGATTATTTGCATAGATAAGACTTAAAATTCTTGCAAAGCACCCA
TACTGAAGAAGTTTATATGGATATTTTTATTAAGAGCTTTGAGCATTTGATCAAGGAAAA
AAGATAAAAAAGTTGTGTTCCCTTTGAAAAAGATGACAATTTGTGTATGAAGTTTATTAC
TGCTGCATGTAATTTACGTTGCATAGTTTTTTCCATTCCTCTCTAAACTTAATTTTAGGT
TAAGGAAGTTGCTGGTAATATTGTGCCTGCTATTGCAAGCACTAATTCAATAGTAAGTGC
TATTGAAATTACTGAAACTATTAAATTATTATAAAGACAGTTTTACAACAACCCTTAAAA
ATACAAAAATAGAGAATTATACATTTAAAATGACATTAAAACTAAAATCCTTGATGCAAA
ACCTGGTAACTTCAATCCTAATTGCATGTCTTGCAACTAGAATTTGCTTCCTCATATTAT
TTATTGTGATTTTAACAAAGTCACTCTTGGAGAGTTTATTAATTCTGAGCTTCGTAGCAA
AGCTATGTAGGATGAAGATGATGATGAGGGAAACGATGATAATAAATTAGTTAACTTTAG
TATTTCAAGTGGTTAATTTATTATATATGAAGAGGATGAGTATCAAGAAGAAGATGAATA
AGAGCAAAACGAAGCAAAGCGCCAAAAATTAATCAGTGAAATATTCAAAGACTTTTCTGA
TAGTAGAGTTGTAGTTACAAATGAGGATAACAACAGCATCCATTAAACTTATCTCTTCTG
TCATATCGAGAACCACAAAATCCCTGGTCTTGACATAGTTCGCTAAGAAAAGAATCCTAA
CAATACAGTCACATGGAAAACAGTGATTGCTTAATCAGACACTGTAAACAAAGATGAGGA
ATAAAAAAAGCAAGAAGAAGAAGAACAAAATAAAAAGAACTATAAGGAAGTTAAAGGAGA
TGACAAAAACAATAACACTTTAGAAATATTAGATTCCGATTCAGAAGATGATTTAGTTAT
TTGCGAAGATAATGATAATCCATCTCAAGGCGCCGCAGAAAAAGAAAAGAGTAAATAATC
AAATGGAAAATAACCTCATTCTGAAACTGATGTATCTTCTTTAAACCAAAAGAGAAAGGC
AGTATAGGAAATTTCTGATGGTGGAGCTATGTAAATAATTGATGACAGTGATGATGAAAT
AATTTTTGAAGATTAATAAGACAACAAAAAGTTAAAAGTGGATTGA