Identifiers and Description

Gene Model Identifier

TTHERM_00241900

Standard Name

UBA15 (Ubiquitin Activating Enzyme 1 paralog )

Aliases

PreTt18928 | 20.m00392 | 3706.m00156

Description

ubiquitin-activating enzyme E1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00899 ) ThiF family
  • ( TIGR01408 ) ubiquitin-activating enzyme E1
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( PF02890 ) Borrelia family of unknown function
  • ( PF02134 ) Repeat in ubiquitin-activating (UBA) protein
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00241900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_181720
WormBaseWBGene000066999.997093137033517e-262locus:uba-1 status:Confirmed
UniProt:Q3S1J5 protein_id
:CAJ30225.1
Tetrahymena borealisEI9_07807.19.997093137033517e-262ubiquitin-activating enzyme E1
family protein (1051 aa)
DictyBaseDDB_G02702729.997093137033517e-262uae1 on chromosome: 1 position
4544769 to 4548249
OxytrichaContig20907.0.g369.997093137033517e-262ThiF family
SGDYKL210W9.997093137033517e-262UBA1 Ubiquitin activating enzy
me (E1), involved in ubiquitin
-mediated protein degradation
and essential for viability

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00241900(coding)
ATGGGTTGCGGTTTATCTAACGAAACGAAGAAAACAAAAGAACCTACTGAAACAAAAAAG
AAGGATAACCCTGATGAGAATCTATATTCTAGATAGATGGCTGTTTATGGTGCGGAAACT
TAGGGTAAGCTTATGAAAATGAAAGTCTTCATTTATGGTCTTTAAGGCGTTGGCATTGAA
GTAGCTAAAAATTTAGTTTTAGCAGGTCCTAGTTAAGTAGTAATTTACGATGATAATATT
TGTAAGTCAGTCGATTAAGGTGTCAATTTTTACATTTAAGAAAAACACGTCAAAAATAAT
AGCACTAGAGCTGAGGCCAGTGCAGAGTAATTGTAATAATTAAATCCTTATTGCCAAGTT
ACAATCCTTAAGGGTGAAATTGATACACAAGTATTATCTTCTTATAATGTTGTTGTTTTC
ACAGATTACTTCAATAAAGAAAAATTGATAGAATTCAATAATTTCTGCAGAGAAAAAGGA
ATCGGTTTTATCTACACAGCAAATCTTGGTTTGTATGGATGTGCATTTGTAGATTTTGGA
TAAAAACATAAAGTTTTTGACAACAATGGAGAAGATCCTAAACACTCTATTGTAGTATCG
ATTACTTAAGATAAAGAAGGTCTAGTAACTACTCATGAGGATAAAAGACATGGTTTGGTA
GATGGAGACCACGTTACTTTTAAAGAAGTTTAAGGAATGACTGAAGTAAATGATTAGGTT
TATAAAGTTACTGTAAAGTCTCCTTTCACTTTCACTATAGCTTAGGATACTTCTAAATTT
AAAGCTTACTAAAGAGAAGGTATTGTCCAACAGGTTAAAGTATGTGAGGAAATATAGTTT
AATTCATTATAATAAAGCTTGAATAACCCCATAGCTCCTGGAAAAGATTGTCTTGAAATG
TGTGATTTTGAAAAAATTGGTAGACCAGAGCAATTACATATTATTTTAAATGGGATATTT
GAATTTTGCAAACACAATAATGGTCAACTTCCACAACTTTTAAATTAAGACCATTCTAAA
TAGTTAAAAGAAATAGTCCATAAGTTATTGGAAAGTAACAAAGCTGATGCAAGCAATAAA
TTTAAAGTAGAAGAAATACCTGATGAATTAATATAAAATGTTTCTTTGTATGCTAGAGCA
CATATCAGTCCAGTTGCTTCTTTCTGGGGTGGTGTAGTAGCCTAAGAAATAGTAAAATTC
ACTGGAAAGTTTACTCCATTAAGGCAATGGCTACATCATGAGGTTTTTGAATGCCTCCCA
GATAGTTAAGTTACTAGAGAAGTAGTTGACAGCTAAAATGGTCATTACGTTGCTATATTT
GGAAAAGAATTCTAGGAATCATTGTCTAAAATCAAATTATTTTTAGTAGGTGCAGGTGCA
CTTGGATGTGAGTATTTGAAAATGTTTGCTCTCATGGGAATGTCAACTGGCTAAAGTGGA
CTTGTAAGTGTTACAGATGATGATAACATTGAAACATCTAATTTAAACAGATAGTTCTTA
TTTAGAAAAGAAAATGTTGGTAAATCTAAATCAGAAACAGCTTGCTAAGTGGCCAAGAAT
ATGAACAACAGATTAAATGTTAAGAGCTACAAACTCAGAGTAGCACCTGAAAATGAGTAA
TTCTTTAACGACGATTTTTGGGTCAGCCTAGATTTTGTAGTTAATGCTGTTGATAATGTT
AAAGCACGTCTTTTTGTTGATGCACAATGTGTCTGGTTTGAAAAACCTTTATTTGAGTCA
GGAACATTGGGTACCAAATGCAATTCTCAAATAGTTATTCCTAAACTTACTCAATCATAT
GGAGATTCAGCAGATCCTCCTGAAGAAAGTATTCCTTTGTGTACTTTAAAGAACTTTCCT
CATTAAATTGAACACACAATTCAATGGGCTAGAGATTACTTTGAAGGAATAATGGTTGAA
GGGCCAAATGAATTATCGCAATTCATTAAAAATCCATAAGAATACTTATCTAAAATGTAA
AGAGAAAACGAAGGTAAAAGTGGTATATTAAGAGCTAAGCTAGAAATTCTATAAAAATTA
GCAATAGCTTTTAATGGAGGAACTTACTAAAATTGTGTTACTCTATCAAGAGAATTATTC
CAAGAAATGTTCACAAATTAAATTGCACAACTCTTACACAGTTTTCCTTTAGACCATAAG
ACTGAAGAAGGATAACCATTCTGGAGTGGACCTAAAAGACCACCATAAATTATTTATTTT
GACGAAAATGATGAGGAACATATCAACTTTATCTAATCGTCTGCAAATATTTTTGCCTAT
TTATTCGGGTTGAAGTATAATACAAACAGAGAAGAAATTAAGAAAATGGCTAAATCTGTT
CATGTTAGAGAATTCAAACCAGGCAATGTTAAAATTAGCACAAATTAAAACGATAACACT
TAAAATGTAGCTGAAGATGATGAACAAATTTGTACAAAAATAGCTGATGAACTATTGAAG
TTGAAAATATCCTCTTCCAAGAAAATTAACACAACCGAATTCGAGAAGGATGATCCTACT
AATTATCATATAGATTACGTTTCAGCAATAGCAAATCTACGTGCTAGAAATTATAAGATT
ACTGAAGTAGATAAATTCAAAGTAAAATTGATTGCAGGTAAAATTATTCCAGCTCTAGCT
ACTACAACAGCTATGGTTGTAGGTGCTGTAGGCTTAGAAATCATTAAATATATCTTGAAA
AAACCTATCACTCAAATAAAAAATTCTTTTATGAATCTTGCATTACCAATGTGGTTATTT
AGCGAGCCTTTACCACCTATGAAGCACAAAGATAAAGATTATGATGAGATCCTTTTAGGC
CCTGTAAAAGCAATACCTCCTGGTTTCACTAATTGGGATAAAATTGATGTTGTAGGACCT
CTAACAGTCCAAGGGCTTTTAGACTATTTCTCATAATAATATTAGGTAAAACTATCAATA
ATATCTGTTGCAAAGATTTGTATTTATAATTCTTATGCTGGTGATTCTGAAAGACTAACT
TAGGATATAGCAGCCTTATATGAAAAACTTAACAAAGCACCTATTTCATAATTTAAAAAA
TTCCTTGAAATTACAGCTAGTGGAGAAACTTTAAATGATGGGGTTGATGTAAATATGCCA
ATTGTTAAATACAAATATAAATGA


>TTHERM_00241900(protein)
MGCGLSNETKKTKEPTETKKKDNPDENLYSRQMAVYGAETQGKLMKMKVFIYGLQGVGIE
VAKNLVLAGPSQVVIYDDNICKSVDQGVNFYIQEKHVKNNSTRAEASAEQLQQLNPYCQV
TILKGEIDTQVLSSYNVVVFTDYFNKEKLIEFNNFCREKGIGFIYTANLGLYGCAFVDFG
QKHKVFDNNGEDPKHSIVVSITQDKEGLVTTHEDKRHGLVDGDHVTFKEVQGMTEVNDQV
YKVTVKSPFTFTIAQDTSKFKAYQREGIVQQVKVCEEIQFNSLQQSLNNPIAPGKDCLEM
CDFEKIGRPEQLHIILNGIFEFCKHNNGQLPQLLNQDHSKQLKEIVHKLLESNKADASNK
FKVEEIPDELIQNVSLYARAHISPVASFWGGVVAQEIVKFTGKFTPLRQWLHHEVFECLP
DSQVTREVVDSQNGHYVAIFGKEFQESLSKIKLFLVGAGALGCEYLKMFALMGMSTGQSG
LVSVTDDDNIETSNLNRQFLFRKENVGKSKSETACQVAKNMNNRLNVKSYKLRVAPENEQ
FFNDDFWVSLDFVVNAVDNVKARLFVDAQCVWFEKPLFESGTLGTKCNSQIVIPKLTQSY
GDSADPPEESIPLCTLKNFPHQIEHTIQWARDYFEGIMVEGPNELSQFIKNPQEYLSKMQ
RENEGKSGILRAKLEILQKLAIAFNGGTYQNCVTLSRELFQEMFTNQIAQLLHSFPLDHK
TEEGQPFWSGPKRPPQIIYFDENDEEHINFIQSSANIFAYLFGLKYNTNREEIKKMAKSV
HVREFKPGNVKISTNQNDNTQNVAEDDEQICTKIADELLKLKISSSKKINTTEFEKDDPT
NYHIDYVSAIANLRARNYKITEVDKFKVKLIAGKIIPALATTTAMVVGAVGLEIIKYILK
KPITQIKNSFMNLALPMWLFSEPLPPMKHKDKDYDEILLGPVKAIPPGFTNWDKIDVVGP
LTVQGLLDYFSQQYQVKLSIISVAKICIYNSYAGDSERLTQDIAALYEKLNKAPISQFKK
FLEITASGETLNDGVDVNMPIVKYKYK


>TTHERM_00241900(gene)
ATGGGTTGCGGTTTATCTAACGAAACGAAGAAAACAAAAGAACCTACTGAAACAAAAAAG
AAGGATAACCCTGATGAGAATCTATATTCTAGATAGATGGCTGTTTATGGTGCGGAAACT
TAGGGTAAGCTTATGAAAATGAAAGTCTTCATTTATGGTCTTTAAGGCGTAATCTTTCAT
CATTTATTTATGAATTTTTTATCAGAAACTAACTAATGCAAAAATTTAAACTTTTAGGTT
GGCATTGAAGTAGCTAAAAATTTAGTTTTAGCAGGTCCTAGTTAAGTAGTAATTTACGAT
GATAATATTTGTAAGTCAGTCGATTAAGGTGTCAATTTTTACATTTAAGAAAAACACGTC
AAAAATAATAGCACTAGAGCTGAGGCCAGTGCAGAGTAATTGTAATAATTAAATCCTTAT
TGCCAAGTTACAATCCTTAAGGGTGAAATTGATACACAAGTATTATCTTCTTATAATGTT
GTTGTTTTCACAGATTACTTCAATAAAGAAAAATTGATAGAATTCAATAATTTCTGCAGA
GAAAAAGGAATCGGTTTTATCTACACAGCAAATCTTGGTTTGTATGGATGTGCATTTGTA
GATTTTGGATAAAAACATAAAGTAAATTTAATAATTATAAATCAATTTGATGATCAATTA
ACGTAAATTTCAATATTTATGAATGAAAGGTTTTTGACAACAATGGAGAAGATCCTAAAC
ACTCTATTGTAGTATCGATTACTTAAGATAAAGAAGGTCTAGTAAGATAATTTAATATAC
AAATAATTTTTTGTTTGTTAAATAAGTTATTTATTTATTTATTTACTAATGTTTTAATAC
TTGAATAATAAATAAATAAGTAAATGGTTGTTGTTTTTGCTAAAAATCAAATTAATTTAT
TAGGTAACTACTCATGAGGATAAAAGACATGGTTTGGTAGATGGAGACCACGTTACTTTT
AAAGAAGTTTAAGGAATGACTGAAGTAAATGATTAGGTTTATAAAGTTACTGTAAAGTCT
CCTTTCACTTTCACTATAGCTTAGGATACTTCTAAATTTAAAGCTTACTAAAGAGAAGGT
ATTCATTCATTCATTTATTTATTTACCAATATAAAAAAGATGTAAAATTTATTTTTTTAA
TTTTTAGGTATTGTCCAACAGGTTAAAGTATGTGAGGAAATATAGTTTAATTCATTATAA
TAAAGCTTGAATAACCCCATAGCTCCTGGAAAAGATTGTCTTGAAATGTGTGATTTTGAA
AAAATTGGTAGACCAGAGCAATTACATATTATTTTAAATGGGATATTTGAATTTTGCAAA
CACAATAATGGTCAACTTCCACAACTTTTAAATTAAGACCATTCTAAATAGTTAAAAGAA
ATAGTCCATAAGTTATTGGAAAGTAACAAAGCTGATGCAAGCAATAAATTTAAAGTAGAA
GAAATACCTGATGAATTAATATAAAATGTTTCTTTGTATGCTAGAGCACATATCAGTCCA
GTTGCTTCTTTCTGGGGTGGTGTAGTAGCCTAAGAAATAGTAAAATTCACTGGAAAGTTT
ACTCCATTAAGGCAATGGCTACATCATGAGGTTTTTGAATGCCTCCCAGATAGTTAAGTT
ACTAGAGAAGTAGTTGACAGCTAAAATGGTCATTACGTTGCTATATTTGGAAAAGAATTC
TAGGAATCATTGTCTAAAATCAAGTATTATAAATTACTGATTAACAGATTTTAATTTTTT
AATTTTATAAATGAAAAGATTATTTTTAGTAGGTGCAGGTGCACTTGGATGTGAGTATTT
GAAAATGTTTGCTCTCATGGGAATGTCAACTGGCTAAAGTGGACTTGTAAGTGTTACAGA
TGATGATAACATTGAAACATCTAATTTAAACAGATAGTTCTTATTTAGAAAAGAAAATGT
TGGTAAATCTAAATCAGAAACAGCTTGCTAAGTGGCCAAGAATATGAACAACGTAAATAA
ATTTAAATATAATTAATTATTCAAGATTTTTATTTTATTTAGAGATTAAATGTTAAGAGC
TACAAACTCAGAGTAGCACCTGAAAATGAGTAATTCTTTAACGACGATTTTTGGGTCAGC
CTAGATTTTGTAGTTAATGCTGTTGATAATGTTAAAGCACGTCTTTTTGTTGATGCACAA
TGTGTCTGGTTTGAAAAAGTAAAGTTATTTGATCATTAAAAAAATAAAAGTATCTATTTT
AAATTGTTTAGCCTTTATTTGAGTCAGGAACATTGGGTACCAAATGCAATTCTCAAATAG
TTATTCCTAAACTTACTCAATCATATGGAGATTCAGCAGATCCTCCTGAAGAAAGTATTC
CTTTGTGTACTTTAAAGAACTTTCCTCATTAAATTGAACACACAATTCAATGGGCTAGAG
ATTACTTTGAAGGAATAATGGTTGAAGGGCCAAATGAATTATCGCAATTCATTAAAAATC
CATAAGAATACTTATCTAAAATGTAAAGAGAAAACGAAGGTAAAAGTGGTATATTAAGAG
CTAAGCTAGAAATTCTATAAAAATTAGCAATAGCTTTTAATGGAGGAACTTACTAAAATT
GTGTTACTCTATCAAGAGAATTATTCCAAGAAATGTTCACAAATTAAATTGCACAACTCT
TACACAGTTTTCCTTTAGACCATAAGGTAGTTATAGCATTAATTAATTAATAAACATGTC
CATCATTATTTTTTATTTCATAAATTAGACTGAAGAAGGATAACCATTCTGGAGTGGACC
TAAAAGACCACCATAAGTAAATCATTATAGTAATTTTATGATATAAAAAGAAATTATTGT
AATTAGATTATTTATTTTGACGAAAATGATGAGGAACATATCAACTTTATCTAATCGTCT
GCAAATATTTTTGCCTATTTATTCGGGTTGAAGTATAATACAAACAGAGAAGAAATTAAG
AAAATGGCTAAATCTGTTCATGTTAGAGAATTCAAACCAGGCAATGTTAAAATTAGCACA
AATTAAAACGATAACACTTAAAATGTAGCTGAAGATGATGAACAAATTTGTACAAAAATA
GCTGATGAACTATTGAGTAAATTTATTAAATTAATTATATTGTTTAAATATTAATTATGC
TATCTAACTGATAGAGTTGAAAATATCCTCTTCCAAGAAAATTAACACAACCGAATTCGA
GAAGGATGATCCTACTAATTATCATATAGATTACGTTTCAGCAATAGCAAATCTACGTGC
TAGAAATTATAAGGTAAAAATAATTTGATAAATTGACTGAAAAGAATATTTATTTTATTT
CAAAAATCAAAAAGATTACTGAAGTAGATAAATTCAAAGTAAAATTGATTGCAGGTAAAA
TTATTCCAGCTCTAGCTACTACAACAGCTATGGTTGTAGGTGCTGTAGGCTTAGAAATCA
TTAAATATATCTTGAAAAAAGTAATTTAAATTTTATTGTTTTGAGTATTTAATTTAATTT
TTTTTAAAAAGCCTATCACTCAAATAAAAAATTCTTTTATGAATCTTGCATTACCAATGT
GGTTATTTAGCGAGCCTTTACCACCTATGAAGCACAAAGATAAAGATTATGATGAGATCC
TTTTAGGCCCTGTAAAAGCAATACCTCCTGGTAATTTAAATTTGCTAGAAAAACTTATAT
TTATTTATCGTTAAATAGGTTTCACTAATTGGGATAAAATTGATGTTGTAGGACCTCTAA
CAGTCCAAGGGCTTTTAGACTATTTCTCATAATAATATTAGGTAAAACTATCAATAATAT
CTGTTGCAAAGATTTGTATTTATAATTCTTATGCTGGTGATTCTGAAAGACTAACTTAGG
ATATAGCAGCCTTATATGAAAAACTTAACAAAGCACCTATTTCATAATTTAAAAAATTCC
TTGAAATTACAGCTAGTGGAGAAACTTTAAATGATGGGGTTGATGTAAATATGCCAATTG
TTAAATACAAATATAAATGA