Identifiers and Description

Gene Model Identifier

TTHERM_00149190

Standard Name

UBA14 (Ubiquitin-Activating enzyme; UBA1 ortholog)

Aliases

PreTt20678 | 12.m00352 | 3700.m00074

Description

ubiquitin-activating enzyme E1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00899 ) ThiF family
  • ( PF07656 ) KWG Leptospira
  • ( PF00627 ) UBA/TS-N domain
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR01257 ) rim ABC transporter
  • ( PF07303 ) Occludin homology domain
  • ( PF00179 ) Ubiquitin-conjugating enzyme
  • ( TIGR01408 ) ubiquitin-activating enzyme E1
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF00417 ) Ribosomal protein S3, N-terminal domain
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( PF00641 ) Zn-finger in Ran binding protein
  • ( PF02134 ) Repeat in ubiquitin-activating (UBA) protein
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00149190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04977.19.997093137033517e-262ubiquitin-activating enzyme E1
family protein (6346 aa)
DictyBaseDDB_G02702729.997093137033517e-262uae1 on chromosome: 1 position
4544769 to 4548249
OxytrichaContig20846.0.g999.997093137033517e-262ThiF family
SGDYKL210W9.997093137033517e-262UBA1 Ubiquitin activating enzy
me (E1), involved in ubiquitin
-mediated protein degradation
and essential for viability
WormBaseWBGene000066993.999538006653402e-149locus:uba-1 status:Confirmed
UniProt:Q3S1J5 protein_id
:CAJ30225.1
Stentor CoeruleusSteCoe_181722.194878508014299e-72

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00149190(coding)
ATGAGCATATAATTTAGTGAAATTAAAAGTCCCATTTTTCAATAAGCTAGTGATTTTGCC
TATGATAGTTCTGGAAGTTAAATTATTTTGGTCAATTCTAGCTCCTTATAAGCTTAATAA
GTGACTTTCGAAAAATAAAGCAGCTTGAATTAGCAAGTAGTAGGTTAATAAGCCCTTAAT
AATTAATAATAGGTTATGTCAGATGATATCTCTGAACAATTAAGCTTTTAAAATACTTCT
TTTACATATAAGTAAAATATTTGTATTCCTGAAGAATATTAGCAAGTTGTAGGCAAAGAA
ATGCTTCCTCAATAGCAAGATAAAGATTAAGATAACACCAAGCAAGATACATAAGTAGTA
AAAAGCGATAAGATTTAGCCAAGTTTAGGGGCATATTTTAACACTTTAAGATTCTCTAAG
TTAAAAAGTTCATAGACAGGGATTTCTATTTCTCCTTCAGGATTGACTGCAACTTGTAAA
GCCTCACAATCAGCTAGTTATGCTATTTGCGGTACAAGTTTTGCACACTAAAACTCCTAT
TATTTAGAGTTAGAATTCCCAAATGGGTGTGAAGGTATAGATTTCGGGTTAGTCTAAATG
CCCGCAAATTTATAAAATCCTTAGTCCCTCAAAACTCATTTGATCACTTACAAGTATAAA
ACATAAAAAACGGTTGGCGTAAAAATTGATACAAATGACTGGACTATTAAAGTTTGGTTT
AATGGAGAATTCTAAAAAGTAAAGTCAAAAAGAATCCCAAAAGGTGATTATTCATTCTGT
CTTAAAATGAATTTGAGAGGTGTAACTTGCATAATTAATCCATTTGCAGAAGATCCTGAA
AAGAAGCTTTCTTTATATTAGAGAAGAACTCATTTGAACGGATAAGTAGAAGCAAAAGAG
GATTAAAATGCTACTGAATAGCCTCTAATTTAAGATTTGCTCATAAAAGTTAAAGATTTA
CTTAATTAAACCTAATAATCACCAAAGCAAGTTGGATCAAACAAAGATGAAAATATTTCT
ATAGGTTATTTAGAAAAAAATAATAATTTAATTGCAATTAAAGATAATAAAATAAAGCTT
ATTAGAAAAAATCATTAAGGCTAATATCCCTTTCATCTTTCGCATTTTTAGAATCGTCCT
ACTAAATTATCTGATATTGTTTTCTTGCAAATATATCTTTCTGAAATCGAAGAGTTGATA
TCATAACCTAATTTATTTGAATAGATTTCTCCAAAAATATCTGAAAATTTATTGAAAAAA
TTAGCATAAGCAATAGAGCTCTATGGACATATAGATGATAATTAAATTTTAGCTGTCCCA
TTCAATTTCTGTGAAATAAAAAGCACAATTGACTCATTAATAGAGAATGTCACTTCCCAC
ATAAATGCTATTTATGAGTACCTCAACCCATCTGTTGTTTAAAATTTACCTGAAGATAAA
TAGGTCTATGTAGCAAACAATATAGATTTAATTAGTAATAATTAAGTTTATCCTAACGAT
GGACTTCCTTTTTTTAATGAAAGTGATGAAGATTTACCTTAGTAGGCAGTATTAGAATAA
GCAAGTAGTGCTGCTGAAAAGGTTGAAGAGCCAGCCTAGTAATAAATCAAATAATAAATT
TAAAAGAAGTCATTTAAAGAAGATACAGATTCTCATAAATCAGCAGTTAGTGTAAAAGAT
CCTATTGAAAACCTGAAAGATATAGCAAAAAATTGGGATATAAGCTCTCTTCATTCTATT
TTATATACTTTATTAAGGTTAGATGAGTAGTTATTTGCAATGACTTTACACGAAGATGCT
TCAAATGAGCTTAAATAGCTGTTTAATACAGGAGTTTCACGTATTTTTGCAGCATTTGGA
AGATTAATTTCCTTTTATAATTACACTAATACAAATTTTTCAATTGAGAATTTGGCTTAA
GCAGGATTGGTAAATATTCACGATTTACAATAAAACCTTCGTCATTTCCTTGATTATTAT
ACTCCTCTTTAAATTTCAAAGGCTTCTAATGTATAAGATATTTAGAAATAAATCTAAACT
CAATTAGAAGGAAACAACTTTGTAAACGGATCTTTAAATTTAGACGTTGGATTAGATGTA
ACTGTGAATTCAATGTCCTATTAAGTTCATAAAAATAGCAAAAACTAAATAAGTGACAAA
AAAGTTAAATTTATAAAGCCTTAAAGAAAATACCTTAGTAATTATATTTGTTCTTTTGAT
TCAGAAGGTTGTGTTAACATCTGGAATACAGAATTAAATCTTCAAAGAGTCGCTATTTCT
GAATTTAAAAAAGAGTTTGTTTTTCCAGTTGAGTGCTAAATTGGTAATGATCTTCGTAAA
AATGAGGAAGAGCTTAATAGCAAAATGAACGAAGCTTCCAACAGTTCAAATTTCTAAAGT
TAACTCTATAAAATTCTTGAAAATTCCATATCTTCATAGTGTAAATATGCTAAGAAGCCT
AAGCCTATTGAAAAATCGATAGTAGCAGACGCAGAAATTATTGAAAAGCTATTAAATTAT
GGTTTTACTGTTAATGTTGCTAAGAAAGCTTGCATTGAAGTTAAAAACGAGAGTGTTGAA
AAAGCATTAGATGTTGCTTTAAGAATACAACAAGAGGAAAATAGTGAATTAGAATAAAAT
AATCAGAAGAGCTCACTTTTCAGTGGTGATGATGAAATTCATGTTAATAGCATAAAATAA
GAGTGGTCATGCGAAATATGTACTTATTAGAACTTTGGCAGATTCTAAAAGTGTGAAATG
TGCTTTTCCCCTGCCCCTGAGAGTGCATATTACACAGAAGAAGAAGTAATGGAGATTATG
CAAGAAAAATTGCTTTAAAAATAGTTAGAAGAAGAAAGAATATTGAAAGAAATTCAAAGA
AAAGAAGAAGAAGAAAATAGAATTAAAAAGGAAACTCTGGAAAGAGAAGAGCAGAGATTA
AAATAATTAGAAGAAAATAAATAAAAAATGAAGGCCTTCTTAGAGTAATCTGAAGCTAAA
AGTGGATTCTTATTAAATTTAAAATAAAATTCTTTAGCCTAACTAATCGCTGGTGTTTCA
TTTAACAGCTAATGTGGTAGCGGTGTCTCTTAAAAGAGCTTGCTTCGTATTAGAAGGTTT
GCAACTAACCCAAATTTACTTAATTAATTTTATAGCTTAACCTCGAAGGGTATTGTTTGT
AATTTAAATGGCTAATATATATAAGAAAATACAATTAACTCACTTGAGAGTATTCTCTTT
TCTAATGAAAATAATCGCTATATTTTTGAAACTCTTTCACCAATAGCTACTGAAAATTCA
GATTTACACAATTTGCTTGCTGTGTCAGAAGCTAATTTATAGTTTGAAGAAGAGAGCATT
ATCGATTGCAGTTGGAGATTAATTTCATAATCTTCCGAGAACGAAACCTATGATTTATTT
ATCTTGACATGCTCCTCAAACAATTAATTAAATTTGCATTAATATAAAATGGTTTTTGAT
ATCCTCGATCCCTATAATCTTTAAAAGAAAGAAATTGAAACATAATTCATTAAAAAAATT
ATAATTAGCACTTAACAAGAAAGAACCGAAGAAGGTCTTATTGTACTATCAGAAAAAAGC
GAAGTAGTTATAGTAGTAATTTAAAATAAAATATTCTATATCCCTATAACTAAATAAGTT
ATGTCTAATGAGATATAAGTAAAAGAACTAAAAGGCAGTGCTGAGAACATTAATTTAATA
TTATCTGGCAGTCTATTTATTACAGATAAAACATAAACTCTTACTATTATTAATATACCC
TAATAAATAACTGTTTAACAAACATAGCCTAATCAAATTGAATAAGATAGCCAAATTGAT
TTATATAATACAATCAATTTCACAGAACAATAGCTTAAATTTTTAAAATAATAACTTTAA
TATTATCAAATAGGCACATTAGCTAATAAACTCTCCTAAAAATCTGAATTATATGATTCA
TTTTCATAACTCAATTCTAAGCATTCATTTAATTTGAGAAATAAACATAAATTTGAAGTA
GAATTTTAATTATAGAATCCTTAATACTTGTAAAGCATTCTATTGGACTTCAGCCTAGTC
TCCCCTTAGAAGGACGCAAAATCACTTCTTCCACTTACAGACTGTATCTTAAAAGAAAAA
GTTGATCAGAATAGCTTCTTTTCTTTTGATACTTGGGAGCCTTAATCTCAACCTAAGACA
TCATAAAATGGAAACTCAAATTTAAATTTAAATGAAAAATCAAATAAATACTTACCTTTA
TCTATTTAACTTTGCACTGGAACTCCTTATTCATAAAAGCATTAATCTAGTTCAATTTTA
TTCCCTAATTAAAGTTCATTCTAAAGCTTTGATTAAAATTGTTGCTTCCTGGTAAAACAT
CTTCACAATAAATATATTGTTGCAGATTCTGTAACTATAGAATCTTACGATCATCCTATT
GAAGGAGGTTATCCAGTAGGCACTTTGTTAATTTTCACTGCTGATCATCCATCTGTTATT
GAACGTGCAGCACACCAGTTTTCTTAAATGACATAAGCAGAATACGATGAATGGAGAGAG
AAAAATCAAGGTAGAAATCTTGAATAATGGGAACCTGTTGCCTGTGTTTCATTCAGCGAG
TCACAAACTATAAAAACTGTTAATGTTGACTACAAAAGGTGTTCAAAGTATATTTTAGTA
ATGCCAACTTCTCTTAGACAAAAGTTCAAGCATTTAACTGGAAATCAATGTACATCTTAT
TAATTTGTTGGTGTTTAAGGTTTTGCTCTGAATGAAGTTTCTCAACTTGAAAATGGCTTT
AATTTGAAAAATTCTAGCTCAAGTGAAATCTAATTTATTTAAAAATATATAAACGAAAAT
GTTACAATTGAAGTTAAGACTCAGCAAAGTAATGAGTGGATTGCTTTAACAGAAGAAAAA
ACTAGCATATTCTTAAAGAACTTTGCTAAAAACACTGTAGTACCAAATTATAAATTAAAT
ACTTCCATAGTAAAGCGCTTAAGTGATCTTGGAGAAGTAGCTAGTTCACTTGCTAATTCT
AGTGATTTGACTCTTCAATTTATTTCTGAAGATATTTTCACATAATCTAAAATATCATAA
ATTCGCATTAAAATAGCAAATAATTAAATAAATAATTTTAATTAAATTTAGTCATTGGGA
TTCACTGTAAAAGGTAGGATTTATGGTGGCTCTGGTCAATCTCTTTCGGAAATATAAAAT
AATATTTTATTAAATCCATCTTACTACGAAACTATAAATGGCAAGATAGTTAGCTAATTA
ATCGCCCTTTCTTCTGCTTCTTACAACTAAGCAACTAGAAATTTAATAGAAGCAGCATCT
TAATATTTAATTTAGGTTATGTCAAGTTCCCATAACTACCTTCTTAATGACGATATGATA
AACCTCATTTATACTAAATTTGACTTAGAAAGATTCATATCTTCAAATATTCTTTAAAAT
CCTACTCGTAAATTCACTTACTAATATAACCTATTGAGAAGTTTCAGCAGATGCACTGGC
TTTTAACAAAAACTTCTTAGCGCTCTTCTTAACCTTCTCCCTTAAATTACAACAAGATAA
ATCCCAGTCACTGAAAGCGGTTTGAGCATTTATTTAAGTCTCTTAAGATGGTGTTAACCT
TAAAACGCTTCTAAAATATTCTTACAATTACTCAATCAACTTCATATAATTTCTAAAAAA
GTATAAGAGAAAAAAGATTCCTATTATAATATTTTGACTTCAAGATTTGACATAAATACT
TTATGCTTTGAAAAAAGTCTTTTCAGTGAGTTATTCCTTTCCAAAGAATATAAATATTCC
CACAGTAATTTACAAGCAAAAGATAATAGCTACTTAAATTCTAAAGTTTACATCACTGAA
GATGTATTTGTTCACGAAATTTATATTGATCTCTAAAAGAAATATAACTTGAATGAAATA
TCCTTAGCATTTAATAGAAACTCTATTTATTAATCCAGTTTTAGAGTGATTGTTTGGAAA
TTTTAAAATAATAAGTAAGAAATGCTAGTAGATGAATAATATGGAAGTGAGACTTTCGTC
TAGTTGTCTAACTACTCTCATGAAAGTTCATCTTTAAAATAATTTTAAAATAGAGAAGAA
ATCTCTACTTTGAAGTTGCTAGAAACAGCGGAAACCTCTTAAGTATCTTCACGTTATCTT
ATTATCTAAATCAATTTTAGTTTGAGACCTTTTATAGGTACTTCTAAATAATTGAGTGAT
ATTCCTTTTTAGAATAACCATTTTAGACCATTAATATAAGGTGTACTTTCATAGGAAGAA
TCTAATGAATAAATTCCTTCATGTTTCCCATAAGATTTCGCTTCCTAATCAGTTGGCATT
GATGCTGCAGGTGTCACAAAATCTAAAATCGATGCTGCAGGAGTCACAAAATCAAAAACT
GATGCTGGAAATTCTTAAATCAATAAGGAGCACTAAAGTTTAGCTATTCTTGATGAAATG
CAAAATAAATTAAAAGCTTTACTCACAAATGAAGAAGCCCATAGAGACATTATAATTAAA
TAAGTTATTGAAATAGAAGAGGTATTAAAACAAAATTATTTACAAGAAAACTGTAGAAGG
TTTAATAATACTAATTAGTAAGCTGCACTTTCTAATGATTGCAATTTATCATATCTCTAC
ACATTAGCTTATAGTTTTTCACAATTTTTAAGAAAAATTAATGAAGTCAACAACAATTCA
GAGGATAAAAAGAATAATTAATGGATTAATTCTGCTACAAACGGAAGAAATAATATTTTC
CATGATGTGTTTGAAACTTTTGTAGTTTTTGATAACAGTTTATTATCATAGGAAATTCTT
ACCCTCCTTGGAGAAGTTCTTATTGATAACTTAAGTGAAAAGGAATGGTTATAGTTTGTT
TTTACTATTCTTAAAAGATATTTGATGCAACCAAAGTAAGCCACACTCCCTATAAACTAA
CTCTTCTCTCAAACAAATCTCATCAAAGCTTTAGACAGGATTTCTATACCTCTTGGAGAA
GTATTGGCTTTCTTAGCTACCTAGTTAAACATTCCTATTGAAAATGTCATACTTGAAACT
TAAGAAAGAGAAATTTCTTATGGATACCTTGCTCCTACTTTAGCTCTGTTATATAATGGA
TTCAAAAATATTCCTAAAATTAGCATTAATTAGAGAGCTCAAAAAAATAAGGAAAATACA
AACAATCAATCTGCTAATCCTAATAAGTTAGCTTAGGTTTTAGACCCAATGAGTTTAAAG
CTCACAAAAAGTGTTTCTCGTGAATTAGAAAGAATAAATAATTAAAAAATTGTAAGTTAA
GACCAAGAATAATCTTAATAAAATAAAATCAACTCAAAAGGATAGAATTCTGCTTAAAAG
GAAGCAAAGTAATCAGATAAAAATGAAGAAGAGGAAGAAGATATTTTTATTGTCCTTCCC
CCTGCTGGAGTAAAAAGAAGTGTATCTCACCCTTTGAAAAATGAAATCCAAAAGAGACAG
TTGCAAAACGAGTCATAATTGCTAACATCTATTGAAGAGCAAGAAGATATTGTAAGACTT
GATTACGATGAATCTTTCAATGTTGCATTTTAAGTTTGTGTTTGGATTGTCGAGCACAAA
AATAAGTTTGATAGCCAAGAGGAGTTCGTTTAACTTATGAAACTATGCTTCAATCTTTTA
GAATTAATCTCTTCCTTGTCTTCAATGAATGGAATTAAGAGAACTCTACTAGCAAATTCT
TTTGATAATAACACCTTCTTTAAGCTTTATTTCTATGTCCTTTCTTCAGGTCACAAAGAA
ATCATTGCTCTACTCTCTCATTTAGTTTTATTATTATCCAATCCTCCTTCTTTCTCATAG
ATAGATTGGGCTTCTTTGAATAAGGAAGAAAGAAGCTTCTTACTTAATGAGAAGTAAAGC
TTAGAAGAAATACAACTCATATTGGTCTTCCAAATTGAATAAATTATGTAGTGGATGCTT
GAGTACTCTATGTATCCTAGTTCTTCAAAAAATAACTTATATGGCATGATTCTCCAAAAG
GAAATAGATTCAGAAGAATGGTCATCTCACTTATAATTTACTATGCAGCTTCTTCTTGAA
GTGAATAAAACTTTGCAAGAAGAATTTAAGCATAAATCCTTTTTGGAAGCCTCTGCATCG
AATCTTAGAAAGGGATCTTATGACTAGAATAGAAGAAGATAGCAATCAGCTGAAAGAAGA
AGCAAGAAAAACTCTTCTCCTAATTAAAATACAAATCAATCCTCTCAAAAAGAAGAAAAT
ATTGATGATGCAGGTGAAGTTGAAGATGAAATAGCTGAAATAACTTAAAAAACATTTATG
GCTACATCTCACGATCCTTCTTAATCTGTAGGTAGATAAATTTCTTAATAACAACAACAC
AATGCTAATACTAACGATTTGGTCCCTGTTGGCATCTCAAGATCTTTGAGTGTCCCAATT
AATAAGCAGCAAATATTAACTCAATATACTAAACAATAAATGCTGGAGTTTGTTGATAAA
AGCATCAGTGAGAGATCTTGCTCTCTTTCTTTGCGTACTGCTATCACACTCATAGATTTA
ATAGAAGCCTCTTCAACAGGTACTTAAGCTAATTAGATATACAACTCAAATGGAAAATTG
TTAAGCTTTATTGATAATGCTTAAATATGGACTTTGCTATTTAAATTCATAGAGTAATTA
AAGCTCAAGTAAATACTTTCTTCAAAGCTTTTTGAAAGACTTGCTAATCTATTCTTTAAC
TATGAATTTTTAACCTCTAAGACTCTGCAATAGATGCTTCTCTCAAAATCCTATGATTTC
CTTATGTTGACACAAAGTCTTTTTAATAAAATTACAAATGAAACTTAATCTCCTAACTTC
CCACCTCATATGAGTGCTGTCCTAAACAGTCCTACTTTAGCTAGCAAGAGAGAATCTGCA
GTTAAAGACCATAAATAATTCTGCTAACTTCTCTTGAATATTATTTTTGAACAGCTCATC
CCTGGCTTAACTTTAGAATCAACAATTACTTCCAGTCTTCCTTCAAAGAGAATATTTGTG
TAAGACATACCTCAATAAATATCTTCAGTAATTGCTAAAAAAACAGGTATTTTATAAACA
AGCTCAATCCACTATTTTATTATAAATGGATGGCTTGATATACTATTGACAAAGAGTACT
CCTAAACCAGAATCATACTACACATAACCTTAAAATGATGTATCATACTGTAAATTAAGC
CCTCTAAGCGCAGCCTCTCTATTAGTGAATATTAGTTAATACTTATTAACTCATTGCAAC
TTTGGTGGTTTAAGAGGTATTGAAATTTCAGACCATGAAGTTCTCATTAAATTATAAATT
ATTTCCATTCTAATATAAATCTTTACTCGCTCTTAAGTTTCTCCAACTACTAATACCTGC
CCTTCTACTTCTTAGCCTTAATGTTTGAAGGAGTTATTTACAACATCTGATTATATTATC
TAAGAAAAAATCACTAACAGTCTTCAAAATTTAATAAAGTGGTACATCTTTAACAAGAGT
AAAGAAACAAAAAATTCACCTTGTTCAGTTAGCTTGTCTTAAATTAGTTCATAAGTTATG
AAGATCTTTGAAGCAACAACTGAATTTTAAAATATTGCAAAAATCTTCTTGAATGAATTA
ATTGTTGTTTGCAAAAATTTAGACAGAGTAATGAAAGAACAATTTAATAAAAATTAGATC
AACGTTTTGATTGCTTAATAAATAACTGATAATGCTTCTTATTTATTAGAAACTATGTTT
GATTTGTTAGTTTGTAATGACGAAATTGCTTCTTATGTGTCATTTTAAGTAAAGGGATTC
TAGTTCCTCTTAGAAAAGATGGGATTAGAAAAAGTATAAAAAGCTAAAAGAGAAAAATTG
ACAATGCCTGAGTGTAAGCCAGCTTAGGAATCTAGTATAATTTGTGGATAAATTATACAT
AAGAATCCAAAGTATGAAATAGCTTCTTACATAGATTCATGCATTTTAGGAACATATTAA
TAGTCTCTCTCATAAGAGGAAAATGATAAATAAAACAAACTACCTGCAAACAAATAAGCT
AACCAATAAAATAAAGAGTCTAGCGCAATATCTTCATCAGCTCCCAGTAGCCTTCTTATC
CATAAAATACTCCCTGAAGAGTAGTGCTCTAAAGCTACTCTTATAAAAACTCCAGGATAG
ACTTGGATTAACAACCCTACAAATTGGAGTGAATAGAAAAATGGAGCTCTAAATCATAAC
TTGATATGGACATAAATGAATGGAAAACAACACTCAGAATGTTATTTAACTATTGAATTA
GAAAATAAGGTCTTCTTATCAAGCATTAAAATTGGCTTTAACTTGTACTGGGCTGACTAT
GAAGATAAAGTTCTTGGTATTCCATCAAGCATTTTAGTAGAATACACTAGCGATCTTTCT
ATACCCTTCAAGCCTCTTACTCATTTATCTACAATTTAAGATTAAGGATATGAAAACTTC
AAAGTAAAAGTAGCAGCCAAAAACTTTGAAAGATTAAGAGAAGATGGAAATGGTGATGTT
GAAAAGCTTCTTAGGGCTAACTATAATTAAGAGGTTAAATTCTTGCGCTTTAGATTTACT
CGTCCTATTATCAACTTTATTGAAAATGGATCAGTATTATAAACTAAATTATTTGAAAAT
ATTGCTATCTCATTAAGCTTTATTAGTGTCATGGGTTACCATACTAATATATTGAACTCC
TAATAAATAACAGAAAAGGTTATTTCTGAATAAGAGTCAAGTGCTATTAAGCTTATCGGA
AAACTTTGCAATTAGTCTTTCTCTTCAACACTTAACTTGATAGCAAACAATGAATCAATA
TTAGATAAAATCAAACGCCACTTTGAAGTTATGAGTTTATTATTAGTAAATCATGAACAC
TGCTTAGCTCCTGTCTTCTTAGCTATTGCTGGAAATAACTAGGAAATGGGTGATTGGATT
CTAACTAATTTCCTAGATCTTAATAAAGTTAGTTCTCATGCAAAGATGGTTAGCGAAATA
GTATGCTCTTAGCTTTCTCATACTCATAAGAGAGTTCAAAAGGTTCATAATTTTGTCCTT
TAATCTGCAGTAAAAGAAATACTTACTCTTCAAGAAGTATCGTCAAACCAATATCAAGCA
GCTTTCCACTTCAATGCTCTTTTACCCTTCGCTGAAACCTGGGCAACATCTATCCATATA
AGCGCTTTAGATTTTAGCACTTAAAATCATCTTGCAAGTGCCAGTGGGGAAAGTAATGAA
AAATATAGCAAATTACTTTTGCCTGTCACTCAAGAAATGATAAACAACCTTATCAAGCTG
TATAAAATTTTCTACTAAACTTCTAAATACAAATTAATAATAAAAATCATAATCACTGCT
CTCAATTTACCAAGACCTTACGTTATAGCTGAAAATATATCATATGAAGAAGAAAAAGTT
GTTAGAGAGAATCTTCTCCTTAACACTTTGAATGAACTATGGGCATAATCTAAAACTGAT
TCTAAGTATCTAGAATTGATAGCTCCTCTCATTTTAAGTAATTAACGCGGAGTTGAATGG
CTTCTACTTGACGAACAAAAGAAACTTTTGTAAATGTTAGGTTAATTGCTTAACTTAATT
AAATAAAGCAACTCAAGCCAACAAAATATGCTTATTGACTATCTTAACTTCTTAAGTGCA
ATCACCACTAATACTACAATCTAAGAAGCTATATGCTCTCAAAAAATGCACATTAATTTC
TACAACTGCTTAAAAGATAACAATAAAAATTCAACAAAACTTATAAAAACATTCTAAGAC
CCTCACATGATTTCAATTATTGTTGAAATTTTGAAAAATGTAGCCTTGTCGTCTCCTGAA
TAGGCTAAAATCTTCGCTAAAGTGTTGAGTGATGATATAAAACTACTAACTTCTAAACGT
GATATGATATACGTCACAAACCTTTTGGTTCCATTACTAAATTCTGAGAAAACATTGTCT
GTTGCCTTCCATCCCTTCGATAGCTTTAGCAACAAATGGCTTGCAGAAGGTAAAAAGATC
CTTGAATACAAGAGAGACAGAAAAGGATAATAATTACCTTAAGATCTTTCAAGTAAATCT
GCATCAGTGTTATCTTCTAATTTAAAGAGACCAAATAGCATTCCTTCATTCGCAACTCAA
CTTGGAAAGAAAGAAGTTGTTAAAGGTATGTTCCCTTGCTGGGATACCTTAACTCAAAGT
TTGACAACAAAATTACTTTGGAATGATAAATAGCGTGAAGCATTTAATAGAAATATTGAA
TTATTTACTAAAAAAACAAATTTATTCTCTCAACTTTCGCAACCTGTAAAAACTTAGGAG
ACTGATCCCACAAAGAAATTACCATAAATGTGCTATTAATGGTAGCTTGTTTAAGTTTAA
GATAAAGATTGCGATCCCTCTATGCTTGAACTTGTTAAAGAAAATGTTTTAAAGCAAGGA
CCATTCTTAATTATAATTGAAGGCTACAATTAAGAACAAAAATGCGTTAGCGGTGTCTTT
AGCAGCCAAAGTATCTAATTATAGAAAGTCGAGACTGAGTCTGGAGAGGCTTAGATTATT
CCTCGCGCTGATGATAACTTTATCTTTTACTATGAAGAAAACTTCTAGATGCATTTCGAT
GTACCACCTGACAACAGCAAGCAGTTTGGTTCGTTGATGCTTATCGAAAAAACTGGAGCC
GGACTTCAATTCTAATATCTTGAAAATGAACGCATATTCATCAGTTATTAATAATAAATT
CCTTCAGTTGTTGATATAAACTTACAAGAGATGACTCCTATCGACACTGATACTAAGAAT
TTCCCAAAAGATGTACCTGCAGAATTCGAGCTAACAAAAGTTGAATATTGGGTCCTTAAA
CCAAAAGAGATTTAATCTAGTTTGCTTTTTTCATAGAACACATCAAAGCATGCTAATTCA
TCTTCATTCTTACAAAATCTTCATAACAATTTACTTTTCTAATCTCAAAACCTCAGCGCA
AGTAGCATAGCCAACTACTATAGAGCTGTTCCAGTTTATTATATTCCAGAAAGTTTAGAC
ATTGAAAAAATATTAAGCATGGTAAATGTTGGTGGTTTCTGGTTAAGCGATGAAGGAAAG
AATACTCTTAGCTTTAAACTAAGACAAAATAAGAAGCATTAAATTTAATTGAATACCAAG
CTCGCTGAAATAGCTAGTGAAGGAACAAGCTCAGATGGAGTTATAGATTTAGAGTTCGAT
GCCTTATAACTTTATGAAAATTGCACAGAAATAACCAACCCATACTTGAATCCACTCACT
AATAAGGTCGACTATTTACCTATAATGCCAATATTTGAAATGTTCTCTCAAGAAGGAGGA
ATATAATAAATTATAGAAGTTATTTAAGCATCTTTGAAGTGTTGGAAAAATACTGAAAGA
GCTGGAAAATGGGAAGTCTTTATGAAAGAACTTAAAAAATTCAGCTTACTTCCAAATTAC
TTTGGACTCTTTATGAAAAACAAAGATTGTATCGAGTTGTTATTTGAACTTTTAGCAGGG
CTCCCTGATGAAATACCTTCATAAGACGATAAAAATAAAAAACTTTCAGGAGGATATAAT
GTTCCCCCTACAACAGGCACTACTACAGTTACTTCAACAACAACAGCAACAACTACCACA
ACTACAACTACAGCCACTACAACTGCTTCTGGAGCTATTAAAGATAAATAGAATGCTGCT
GGATCTAAAAAGTGGGATGAAGAAGAGTAAAAAGCTGTTAATTATAGTTACCAAGTGCTA
AAAGATACATTTAAATTAGGATAAGATAATGCTGTTAGAGCTGCTGCTCTAGAACATGGA
CTTATTGAAGCCATTCTTGAAAAAATAGCTTAAACTTCAAAAGAAATAAAGAGAACCTTT
GTTGCTGATTCTACCTCAAATGAAGAAGAATAGGAAGATAATAATTTAACACTCACAAAA
TAAGCTTCAGAAGATGATGGTAAAAAGAAAATTGTACAGAAAAAAGGTATCGGTTATGGT
TCAGACAATACTGGATAAAACCAAAAATGGAATACTAATGATTATATAGAATCTAAAAAG
GCTAGATCTGAATCTCTCAAGAATCTTGTTGCAGTTTTAGAAGCATTTTTGGACTTCAAA
AACTGGGAACCACCAAAATTGTTAGTAGAATAACTGATGTCAAGTGCTCTATTACCTTTA
GTAGAATCATCTTTAAGAAGTGGTTCTCTATTAGAAATGTCAAAGGATAAAGAATTGGTT
TTCACTTATTTGAGTTTGTTGAGAGTCATTGCTAAAAATAGTTGTTTAGTCCCTTGTTTA
TTGCCTCTTGATCCTAGATATATTCCTAAGCAAACTGAATCGGTACTCTTCCTTATTGGA
TAATTAAAGGATACTGCCAAAATTTTCTTAAGTTGCATGACTGCTAAGACTGATAACACA
TCTTCATAACAATAGTAAGAAGAGACCGCTAATTCTAAAAAATTAGCTGATGAAATTCTT
TTAACATTTGAAGCAATTAACGACGCTTGCAAGCATTATCAATAAGAACATGAAGAAGAA
GAAGATTTAAACAGCTAGCAAGATGCTATCAATTAGGTATTAGAATTACCCCTACCTTAA
AAATATAAAATATTACTGTAAGATTTGAGGTTCGATTATACTTCATTCAAAAATGAGCAA
GGAAAGTATAAGCACCACTACTCTTCAAGTATCACAACTTCTTATACCCCTCCTTAAGCT
AAAATGGTTCGTCTTGCTTAAGAATTAGCAGATTTATCAACTGCACTTCCTATTGATCAT
ACAAATTCTATATTTGTTAGATGCGATACAGATAGAGTAGATGTAATGAAATGTATGGTT
ATGGGTTCTAAGGGAACTCCATACGCACACGGAGCTTTTATTTTTGATGTATACTTCAGT
GATGAATATCCTAACTAGCCTCCTAAATGCAATCTTGAAACAACTGGTGCTGGTAAAGTC
AGATTTAATCCTAATTTGTATGCTTGTGGTAAAGTTTGTCTCTCTCTGCTTGGTACTTGG
AGAGGTAACGCTAGTGAGAATTGGGATCCTAAGATTAGTACTTTACTATAAATTTTAGTT
AGTTTATAAGCAATTATTATGAGTGAAGAAGTATATTTCAATGAACCAGGATTTGAAGGA
GAAGCTGGCTCTGAGGAAGGAGAGAGAAAGAATGAAGCTTATTCTAACATCGTTAGATAT
TGCAATATTAAATATGCTATGATAGATTAAATTAAAAATCCTCCTGAAGGTTTCTAAGCT
GTTATTATGAGACACTTCTACCTTAAGAAGTAAGAAATTCTTGAAGAATGTTAAAAATGG
ATTAAATACGCAGATGTAAGATAGGCTTCTTATGTTGGCTTAGTTAATGATCATAATAGC
TCATGGTGTGCAGAATTCAAAACTAAATATCCATAAATGTTGCGTGAAGCAGTTACTGAA
CTAGAGGAAGTTCTTAATTCAATCCCACCTCCAAGCGCTTAAGAAACTAAACTTAAACTT
AAAAACATCAAGAAGAAACCAAAGAAACTTGAAAAGAAGCAATAGTATGACATCACTTAA
GGTGTTGCTAAAATTGACGACATTGATGTTAAGTACGATGATGAAGTAGAAGAAAAGAAA
GAAGATAATAAAGAAAAAGATTTTATTGATATTAATGATGAAAAAGTTAAGGATAGATGG
AGCAGATATATTGGAGCTATGGGTATTGATGCCGTAGCTAAATAGTCTAAGTGTTCAGTA
TTCTTGAGCGGTTTAGGCTCTTTAGGTGTCGAAATCTCCAAGAATTTAGTCATGAGTGGT
ATTAAGAGACTTACTATACATGATTCTAAGAAAACTTAATTCAGTGATTTGTCAGGACAA
TTTTACTTGGGAGAAGAAGATATTGGTAAGAATAGGGCTGAATAAAGCTTAAAGAAAATC
AGATAACTTAATCACTACGTCAAAGTAGATACAGCAATGCTTGACAAAGAGCTTCCTGAA
ACTGAAGAGGGATTAAAAGAAGACTTAAAATTGCACGATTACAATATTGTTGTTCTCACT
GAAGTGCTTTCTATGAAAAAATAAATTTTAATCAATGAATTCTGCCGCTCTAGAGGTATT
AAATTTATTAGTGCTGATGTTTTAGGTCCTTGGTGTAGACTATTTAATGACTTTGGGGAT
AAATTCGAAGTCATTGATAAGAATGGAGAAGATCCTTAGGAAGTAATGATAAAAAATATA
ACTAATGCTGAAAAAGGTGTTGTTACTCTGCTTCCTGGAGTAAAACATCCTTTTGAAGAT
GGTGAGCATGTTATATTCTCAGAAGTCTTGGGAATGGAACTCTAATAAGAAAAAGGAAAA
GAAGAAACTTAAACAATGACTATGATGGGTGGAGACGAATCTTCCAAACCATCAATTAAT
AGCACTATTCATAAGATTAGAGTAATTAACTCCAATTCATTTGAAATTGGAGATACTAGA
GGATTTACCAATTACGTTAGAAATGGTATCGCTAAAAATATAAAAACTCCTGTTAACATT
TCCTTCAAGAGTATGGCAAATGTCTTTAATGTCTCAAAATTAGATGAAGTTCCTTTTGAT
CCAAATTTAATAATTCATGATTTTGAAAAAATAGAAAATCCTCATATCTTATTCTTAGCA
TTTAAAGTACTTGAAGAATACTAAAGTACCCACAAAGGATGTTTACCACAGTGCTGGAAC
GCTGATGATGCCAAACAATTCTTGACTTTAGCAGAACCAGTAATAGCTAAATATTACCCT
GATTCTTCCTAGCAACCTAAAAACCTTAAAGAAATTCTTTTACGTTTTGCTTTAACTGTT
AATAGTAATGTTGGTCCATTTGCAGCTTTCTTAGGTGGTTTTGTCACTCAGGAAATCGTT
AAAGCAATAACTAATAAGTATATTCCTACTTCTTAAGTATTTTTCTCAGATTGTATGGAA
ATCATTCCAGAAAGCGGAGATCTAAATATCAATAATTACGCATCTTATATAGAAAAGAAT
TATGCCTTAGAGTTTGCTCCTACTAATGACAGAAATGATGGTATCCGCCATGCTATCGGA
AACACACTCCTTAATTAAATTAAATTCTGCAATCTCTTTATGATTGGATGTGGTGCTATA
GGATGTGAACTTCTTAAGAATTTTGCTATGATTAACCTAGGAACAGGCGTTGATAAGCAA
AATGGAAAAATAGGCTAACTTACAATTACAGATCCTGATCATATTGAAGTATCTAACTTA
AATAGATAATTCCTTTTCCGTGAGAAACATTTACGTAAGCCAAAATCATAAACTGCAGCA
GCATCAGCTATTCAAATGAATCCTCTATTAAAGGATCACATTTTAGCTCGTTTGGATAAG
GTTCATGATGGAACAATCAATATCTTCTCTGATAAATTCTTCTCAACTTTGAATGTAGTT
GCCAACGCACTTGATAATGTTTAAGCAAGAAGATATGTTGATTCTAGATGTGTAAGTAAC
AAAAAGCCTTTGTTAGAAAGTGGTACACTTGGTCCTAAGGGACACGTCCAAGTAATCCTT
CCTTATAAAACTGAAAGTTATGGAAGTCAGTAAGATCCTTAGGAAGAGGGAGAAATACCT
CACTGCACTTTAAAGATGTTCCCTGAAGAAACTTTACACTGTGTTGAATGGGCTCGTGAC
AAATTTGGAAAGCTATTCACTTTGAGACCAAAGAGCGTAAATAAAATCTTAGAAGATTCT
AATTATGACCCATAAGGTGGACAAGAATTAAAGGAATTCAAAGAAGCAATAAAATTATTA
GAGAAGAGACCCCAGTCATTCTCTGATTGCATTGCCTATGCTGTCAAAAAATTCTATAAA
TACTTCAGAAACGACATCTGCTAACTTATGTACACATATCCTATTGATTCAAAAACTAAG
GATGGCGAACCTTTCTGGAAACTCCCTAAGCGACCTCCTACTGATATTAGCTTTGATCCT
AATAATTAATTACATCGTGATTTCGTCACTGCTTTAGCTGTTTTACGTGCCAAGATATTC
TAGGTAGAGTATCCAAAGTCATTTAGAACTGAAGCTGAGAAAATAAAAATTGCTTAAGAG
GCTAGTATAGTAAAGATAGAAGATTTTAAACCATCAGAAAATAAAGCCTAAGCCATTTCA
TCAGAAGTAAACAAAGATAAAAAAACAGATGAGAATGATAAAGATGAATAAGAGGCACAA
GAAGAAGACCAACATTCAAATAAGATAATGGATGAAGTCGCTGAAAAGGCTATGCTCATG
AAAAAGCTCTCTGAAATTAAGAAAGTTATTCCTGAAGAGTATTTCAAGCCAAATACTGAA
AAGCACCTTTTACTTGCAGAGGAATTTGAGAAGGATGAGGATGATAATGGTCACATAGAT
TTAATTTATGCAATGGCTAACTGCAGGTCTACTAATTACAAACTTGCTCCAATGGATTGG
ATTTAAGTTAAGATTAAAGCTGGCCGTATTGTTCCTGCTTTAGCTACAACCACTGCAACA
GTCGCTGGTTTGCAAACAATAGAATTAATAAAAATATTGAAAAATGAAAAGCTCAGTAAT
ATGAAGAATGCTTTCTTGAATTTAGCTGTCCCTCTCATTCAACTCACAGAACCTTAGAAA
GCTGAATAAATTAAAATACATGAAGAGTTAGAAGTTACACTTTGGGATAGATGGGAAGTG
TCCCTGGGTTAAAATGTAACTCTAAAATAGGTTTTCTAACATTTCGAAACTAAATATAAG
CTTAACGTTTGCGATATAATAAGTGGAAGCAAACCTATTTATTTAAGTACTGTGATGGAC
ATAGCAGGAAAAGAACATGAAAAAGAAAAGACTTTGAATAGCCAAATAACCGATATTATT
GAAGTCGAAGATGATTACATTGATTTAATATTTACTTTCTCAAATAAGAAAGGAGAAAAA
GTAAAACAAACTCCTCTTGTACGCATTTAATTCAAGTGA


>TTHERM_00149190(protein)
MSIQFSEIKSPIFQQASDFAYDSSGSQIILVNSSSLQAQQVTFEKQSSLNQQVVGQQALN
NQQQVMSDDISEQLSFQNTSFTYKQNICIPEEYQQVVGKEMLPQQQDKDQDNTKQDTQVV
KSDKIQPSLGAYFNTLRFSKLKSSQTGISISPSGLTATCKASQSASYAICGTSFAHQNSY
YLELEFPNGCEGIDFGLVQMPANLQNPQSLKTHLITYKYKTQKTVGVKIDTNDWTIKVWF
NGEFQKVKSKRIPKGDYSFCLKMNLRGVTCIINPFAEDPEKKLSLYQRRTHLNGQVEAKE
DQNATEQPLIQDLLIKVKDLLNQTQQSPKQVGSNKDENISIGYLEKNNNLIAIKDNKIKL
IRKNHQGQYPFHLSHFQNRPTKLSDIVFLQIYLSEIEELISQPNLFEQISPKISENLLKK
LAQAIELYGHIDDNQILAVPFNFCEIKSTIDSLIENVTSHINAIYEYLNPSVVQNLPEDK
QVYVANNIDLISNNQVYPNDGLPFFNESDEDLPQQAVLEQASSAAEKVEEPAQQQIKQQI
QKKSFKEDTDSHKSAVSVKDPIENLKDIAKNWDISSLHSILYTLLRLDEQLFAMTLHEDA
SNELKQLFNTGVSRIFAAFGRLISFYNYTNTNFSIENLAQAGLVNIHDLQQNLRHFLDYY
TPLQISKASNVQDIQKQIQTQLEGNNFVNGSLNLDVGLDVTVNSMSYQVHKNSKNQISDK
KVKFIKPQRKYLSNYICSFDSEGCVNIWNTELNLQRVAISEFKKEFVFPVECQIGNDLRK
NEEELNSKMNEASNSSNFQSQLYKILENSISSQCKYAKKPKPIEKSIVADAEIIEKLLNY
GFTVNVAKKACIEVKNESVEKALDVALRIQQEENSELEQNNQKSSLFSGDDEIHVNSIKQ
EWSCEICTYQNFGRFQKCEMCFSPAPESAYYTEEEVMEIMQEKLLQKQLEEERILKEIQR
KEEEENRIKKETLEREEQRLKQLEENKQKMKAFLEQSEAKSGFLLNLKQNSLAQLIAGVS
FNSQCGSGVSQKSLLRIRRFATNPNLLNQFYSLTSKGIVCNLNGQYIQENTINSLESILF
SNENNRYIFETLSPIATENSDLHNLLAVSEANLQFEEESIIDCSWRLISQSSENETYDLF
ILTCSSNNQLNLHQYKMVFDILDPYNLQKKEIETQFIKKIIISTQQERTEEGLIVLSEKS
EVVIVVIQNKIFYIPITKQVMSNEIQVKELKGSAENINLILSGSLFITDKTQTLTIINIP
QQITVQQTQPNQIEQDSQIDLYNTINFTEQQLKFLKQQLQYYQIGTLANKLSQKSELYDS
FSQLNSKHSFNLRNKHKFEVEFQLQNPQYLQSILLDFSLVSPQKDAKSLLPLTDCILKEK
VDQNSFFSFDTWEPQSQPKTSQNGNSNLNLNEKSNKYLPLSIQLCTGTPYSQKHQSSSIL
FPNQSSFQSFDQNCCFLVKHLHNKYIVADSVTIESYDHPIEGGYPVGTLLIFTADHPSVI
ERAAHQFSQMTQAEYDEWREKNQGRNLEQWEPVACVSFSESQTIKTVNVDYKRCSKYILV
MPTSLRQKFKHLTGNQCTSYQFVGVQGFALNEVSQLENGFNLKNSSSSEIQFIQKYINEN
VTIEVKTQQSNEWIALTEEKTSIFLKNFAKNTVVPNYKLNTSIVKRLSDLGEVASSLANS
SDLTLQFISEDIFTQSKISQIRIKIANNQINNFNQIQSLGFTVKGRIYGGSGQSLSEIQN
NILLNPSYYETINGKIVSQLIALSSASYNQATRNLIEAASQYLIQVMSSSHNYLLNDDMI
NLIYTKFDLERFISSNILQNPTRKFTYQYNLLRSFSRCTGFQQKLLSALLNLLPQITTRQ
IPVTESGLSIYLSLLRWCQPQNASKIFLQLLNQLHIISKKVQEKKDSYYNILTSRFDINT
LCFEKSLFSELFLSKEYKYSHSNLQAKDNSYLNSKVYITEDVFVHEIYIDLQKKYNLNEI
SLAFNRNSIYQSSFRVIVWKFQNNKQEMLVDEQYGSETFVQLSNYSHESSSLKQFQNREE
ISTLKLLETAETSQVSSRYLIIQINFSLRPFIGTSKQLSDIPFQNNHFRPLIQGVLSQEE
SNEQIPSCFPQDFASQSVGIDAAGVTKSKIDAAGVTKSKTDAGNSQINKEHQSLAILDEM
QNKLKALLTNEEAHRDIIIKQVIEIEEVLKQNYLQENCRRFNNTNQQAALSNDCNLSYLY
TLAYSFSQFLRKINEVNNNSEDKKNNQWINSATNGRNNIFHDVFETFVVFDNSLLSQEIL
TLLGEVLIDNLSEKEWLQFVFTILKRYLMQPKQATLPINQLFSQTNLIKALDRISIPLGE
VLAFLATQLNIPIENVILETQEREISYGYLAPTLALLYNGFKNIPKISINQRAQKNKENT
NNQSANPNKLAQVLDPMSLKLTKSVSRELERINNQKIVSQDQEQSQQNKINSKGQNSAQK
EAKQSDKNEEEEEDIFIVLPPAGVKRSVSHPLKNEIQKRQLQNESQLLTSIEEQEDIVRL
DYDESFNVAFQVCVWIVEHKNKFDSQEEFVQLMKLCFNLLELISSLSSMNGIKRTLLANS
FDNNTFFKLYFYVLSSGHKEIIALLSHLVLLLSNPPSFSQIDWASLNKEERSFLLNEKQS
LEEIQLILVFQIEQIMQWMLEYSMYPSSSKNNLYGMILQKEIDSEEWSSHLQFTMQLLLE
VNKTLQEEFKHKSFLEASASNLRKGSYDQNRRRQQSAERRSKKNSSPNQNTNQSSQKEEN
IDDAGEVEDEIAEITQKTFMATSHDPSQSVGRQISQQQQHNANTNDLVPVGISRSLSVPI
NKQQILTQYTKQQMLEFVDKSISERSCSLSLRTAITLIDLIEASSTGTQANQIYNSNGKL
LSFIDNAQIWTLLFKFIEQLKLKQILSSKLFERLANLFFNYEFLTSKTLQQMLLSKSYDF
LMLTQSLFNKITNETQSPNFPPHMSAVLNSPTLASKRESAVKDHKQFCQLLLNIIFEQLI
PGLTLESTITSSLPSKRIFVQDIPQQISSVIAKKTGILQTSSIHYFIINGWLDILLTKST
PKPESYYTQPQNDVSYCKLSPLSAASLLVNISQYLLTHCNFGGLRGIEISDHEVLIKLQI
ISILIQIFTRSQVSPTTNTCPSTSQPQCLKELFTTSDYIIQEKITNSLQNLIKWYIFNKS
KETKNSPCSVSLSQISSQVMKIFEATTEFQNIAKIFLNELIVVCKNLDRVMKEQFNKNQI
NVLIAQQITDNASYLLETMFDLLVCNDEIASYVSFQVKGFQFLLEKMGLEKVQKAKREKL
TMPECKPAQESSIICGQIIHKNPKYEIASYIDSCILGTYQQSLSQEENDKQNKLPANKQA
NQQNKESSAISSSAPSSLLIHKILPEEQCSKATLIKTPGQTWINNPTNWSEQKNGALNHN
LIWTQMNGKQHSECYLTIELENKVFLSSIKIGFNLYWADYEDKVLGIPSSILVEYTSDLS
IPFKPLTHLSTIQDQGYENFKVKVAAKNFERLREDGNGDVEKLLRANYNQEVKFLRFRFT
RPIINFIENGSVLQTKLFENIAISLSFISVMGYHTNILNSQQITEKVISEQESSAIKLIG
KLCNQSFSSTLNLIANNESILDKIKRHFEVMSLLLVNHEHCLAPVFLAIAGNNQEMGDWI
LTNFLDLNKVSSHAKMVSEIVCSQLSHTHKRVQKVHNFVLQSAVKEILTLQEVSSNQYQA
AFHFNALLPFAETWATSIHISALDFSTQNHLASASGESNEKYSKLLLPVTQEMINNLIKL
YKIFYQTSKYKLIIKIIITALNLPRPYVIAENISYEEEKVVRENLLLNTLNELWAQSKTD
SKYLELIAPLILSNQRGVEWLLLDEQKKLLQMLGQLLNLIKQSNSSQQNMLIDYLNFLSA
ITTNTTIQEAICSQKMHINFYNCLKDNNKNSTKLIKTFQDPHMISIIVEILKNVALSSPE
QAKIFAKVLSDDIKLLTSKRDMIYVTNLLVPLLNSEKTLSVAFHPFDSFSNKWLAEGKKI
LEYKRDRKGQQLPQDLSSKSASVLSSNLKRPNSIPSFATQLGKKEVVKGMFPCWDTLTQS
LTTKLLWNDKQREAFNRNIELFTKKTNLFSQLSQPVKTQETDPTKKLPQMCYQWQLVQVQ
DKDCDPSMLELVKENVLKQGPFLIIIEGYNQEQKCVSGVFSSQSIQLQKVETESGEAQII
PRADDNFIFYYEENFQMHFDVPPDNSKQFGSLMLIEKTGAGLQFQYLENERIFISYQQQI
PSVVDINLQEMTPIDTDTKNFPKDVPAEFELTKVEYWVLKPKEIQSSLLFSQNTSKHANS
SSFLQNLHNNLLFQSQNLSASSIANYYRAVPVYYIPESLDIEKILSMVNVGGFWLSDEGK
NTLSFKLRQNKKHQIQLNTKLAEIASEGTSSDGVIDLEFDALQLYENCTEITNPYLNPLT
NKVDYLPIMPIFEMFSQEGGIQQIIEVIQASLKCWKNTERAGKWEVFMKELKKFSLLPNY
FGLFMKNKDCIELLFELLAGLPDEIPSQDDKNKKLSGGYNVPPTTGTTTVTSTTTATTTT
TTTTATTTASGAIKDKQNAAGSKKWDEEEQKAVNYSYQVLKDTFKLGQDNAVRAAALEHG
LIEAILEKIAQTSKEIKRTFVADSTSNEEEQEDNNLTLTKQASEDDGKKKIVQKKGIGYG
SDNTGQNQKWNTNDYIESKKARSESLKNLVAVLEAFLDFKNWEPPKLLVEQLMSSALLPL
VESSLRSGSLLEMSKDKELVFTYLSLLRVIAKNSCLVPCLLPLDPRYIPKQTESVLFLIG
QLKDTAKIFLSCMTAKTDNTSSQQQQEETANSKKLADEILLTFEAINDACKHYQQEHEEE
EDLNSQQDAINQVLELPLPQKYKILLQDLRFDYTSFKNEQGKYKHHYSSSITTSYTPPQA
KMVRLAQELADLSTALPIDHTNSIFVRCDTDRVDVMKCMVMGSKGTPYAHGAFIFDVYFS
DEYPNQPPKCNLETTGAGKVRFNPNLYACGKVCLSLLGTWRGNASENWDPKISTLLQILV
SLQAIIMSEEVYFNEPGFEGEAGSEEGERKNEAYSNIVRYCNIKYAMIDQIKNPPEGFQA
VIMRHFYLKKQEILEECQKWIKYADVRQASYVGLVNDHNSSWCAEFKTKYPQMLREAVTE
LEEVLNSIPPPSAQETKLKLKNIKKKPKKLEKKQQYDITQGVAKIDDIDVKYDDEVEEKK
EDNKEKDFIDINDEKVKDRWSRYIGAMGIDAVAKQSKCSVFLSGLGSLGVEISKNLVMSG
IKRLTIHDSKKTQFSDLSGQFYLGEEDIGKNRAEQSLKKIRQLNHYVKVDTAMLDKELPE
TEEGLKEDLKLHDYNIVVLTEVLSMKKQILINEFCRSRGIKFISADVLGPWCRLFNDFGD
KFEVIDKNGEDPQEVMIKNITNAEKGVVTLLPGVKHPFEDGEHVIFSEVLGMELQQEKGK
EETQTMTMMGGDESSKPSINSTIHKIRVINSNSFEIGDTRGFTNYVRNGIAKNIKTPVNI
SFKSMANVFNVSKLDEVPFDPNLIIHDFEKIENPHILFLAFKVLEEYQSTHKGCLPQCWN
ADDAKQFLTLAEPVIAKYYPDSSQQPKNLKEILLRFALTVNSNVGPFAAFLGGFVTQEIV
KAITNKYIPTSQVFFSDCMEIIPESGDLNINNYASYIEKNYALEFAPTNDRNDGIRHAIG
NTLLNQIKFCNLFMIGCGAIGCELLKNFAMINLGTGVDKQNGKIGQLTITDPDHIEVSNL
NRQFLFREKHLRKPKSQTAAASAIQMNPLLKDHILARLDKVHDGTINIFSDKFFSTLNVV
ANALDNVQARRYVDSRCVSNKKPLLESGTLGPKGHVQVILPYKTESYGSQQDPQEEGEIP
HCTLKMFPEETLHCVEWARDKFGKLFTLRPKSVNKILEDSNYDPQGGQELKEFKEAIKLL
EKRPQSFSDCIAYAVKKFYKYFRNDICQLMYTYPIDSKTKDGEPFWKLPKRPPTDISFDP
NNQLHRDFVTALAVLRAKIFQVEYPKSFRTEAEKIKIAQEASIVKIEDFKPSENKAQAIS
SEVNKDKKTDENDKDEQEAQEEDQHSNKIMDEVAEKAMLMKKLSEIKKVIPEEYFKPNTE
KHLLLAEEFEKDEDDNGHIDLIYAMANCRSTNYKLAPMDWIQVKIKAGRIVPALATTTAT
VAGLQTIELIKILKNEKLSNMKNAFLNLAVPLIQLTEPQKAEQIKIHEELEVTLWDRWEV
SLGQNVTLKQVFQHFETKYKLNVCDIISGSKPIYLSTVMDIAGKEHEKEKTLNSQITDII
EVEDDYIDLIFTFSNKKGEKVKQTPLVRIQFK


>TTHERM_00149190(gene)
ATGAGCATATAATTTAGTGAAATTAAAAGTCCCATTTTTCAATAAGCTAGTGATTTTGCC
TATGATAGTTCTGGAAGTTAAATTATTTTGGTCAATTCTAGCTCCTTATAAGCTTAATAA
GTGACTTTCGAAAAATAAAGCAGCTTGAATTAGCAAGTAGTAGGTTAATAAGCCCTTAAT
AATTAATAATAGGTTATGTCAGATGATATCTCTGAACAATTAAGCTTTTAAAATACTTCT
TTTACATATAAGTAAAATATTTGTATTCCTGAAGAATATTAGCAAGTTGTAGGCAAAGAA
ATGCTTCCTCAATAGCAAGATAAAGATTAAGATAACACCAAGCAAGATACATAAGTAGTA
AAAAGCGATAAGATTTAGCCAAGTTTAGGGGCATATTTTAACACTTTAAGATTCTCTAAG
TTAAAAAGTTCATAGACAGGGATTTCTATTTCTCCTTCAGGATTGACTGCAACTTGTAAA
GCCTCACAATCAGCTAGTTATGCTATTTGCGGTACAAGTTTTGCACACTAAAACTCCTAT
TATTTAGAGTTAGAATTCCCAAATGGGTGTGAAGGTATAGATTTCGGGTTAGTCTAAATG
CCCGCAAATTTATAAAATCCTTAGTCCCTCAAAACTCATTTGATCACTTACAAGTAATAT
TAAATATATCTTAATAAAATGTTTATCTAGATCAATACTCCATGAACAAGATGCTATACT
AAATTATACATAAATACATCTTGAAATCAATACATAATTTCTGTATCTCACATTTTTATT
TTCAAGCAAATAAAATAACTAGAAGCACAAACAAACAAACATTAAAAAAAACATATAATA
GAAAAATAATTATAATTTCATCTTATTGAAAAAATGATTCAATAAACCAAAAAATTTCAA
TATTAGGATTTAAAATAAAAGTTAACAATTATATATAGTTATAAAAATAAGCTTATCATT
TTTTAAACATCTATTATAGGTATAAAACATAAAAAACGGTTGGCGTAAAAATTGATACAA
ATGACTGGACTATTAAAGTTTGGTTTAATGGAGAATTCTAAAAAGTAAAGTCAAAAAGAA
TCCCAAAAGGTGATTATTCATTCTGTCTTAAAATGAATTTGAGAGGTGTAACTTGCATAA
TTAATCCATTTGCAGAAGATCCTGAAAAGAAGCTTTCTTTATATGTAAATTTATTTTTAT
TTTTATTAAATCTGAGATTCCGCTTTTATCGTATCTTTTCTTAAACCCTGATCTTATTGC
CTTTAATTTTCCTTACACATTTCAAATTAGCTTATTTTTTGTGATCAAATGAAATTTAAA
AATCTTTAATTTAACACAATAATTATTTTTAAAGTAGAGAAGAACTCATTTGAACGGATA
AGTAGAAGCAAAAGAGGATTAAAATGCTACTGAATAGCCTCTAATTTAAGATTTGCTCAT
AAAAGTTAAAGATTTACTTAATTAAACCTAATAATCACCAAAGCAAGTTGGATCAAACAA
AGATGAAAATATTTCTATAGGTTATTTAGAAAAAAATAATAATTTAATTGCAATTAAAGA
TAATAAAATAAAGCTTATTAGAAAAAATCATTAAGGCTAATATCCCTTTCATCTTTCGCA
TTTTTAGAATCGTCCTACTAAATTATCTGATATTGTTTTCTTGCAAATATATCTTTCTGA
AATCGAAGAGTTGATATCATAACCTAATTTATTTGAATAGATTTCTCCAAAAATATCTGA
AAATTTATTGAAAAAATTAGCATAAGCAATAGAGCTCTATGGACATATAGATGATAATTA
AATTTTAGCTGTCCCATTCAATTTCTGTGAAATAAAAAGCACAATTGACTCATTAATAGA
GAATGTCACTTCCCACATAAATGCTATTTATGAGTACCTCAACCCATCTGTTGTTTAAAA
TGTAAAATTTGATGGTTTTTATAAAGTTTTAATAAATACTTTTTGCTATTAATATAAAGT
TACCTGAAGATAAATAGGTCTATGTAGCAAACAATATAGATTTAATTAGTAATAATTAAG
TTTATCCTAACGATGGACTTCCTTTTTTTAATGAAAGTGATGAAGATTTACCTTAGTAGG
CAGTATTAGAATAAGCAAGTAGTGCTGCTGAAAAGGTTGAAGAGCCAGCCTAGTAATAAA
TCAAATAATAAATTTAAAAGAAGTCATTTAAAGAAGATACAGATTCTCATAAATCAGCAG
TTAGTGTAAAAGATCCTATTGAAAACCTGAAAGATATAGCAAAAAATTGGGATATAAGCT
CTCTTCATTCTATTTTATATACTTTATTAAGGTTAGATGAGTAGTTATTTGCAATGACTT
TACACGAAGATGCTTCAAATGAGCTTAAATAGCTGTTTAATACAGGAGTTTCACGTATTT
TTGCAGCATTTGGAAGATTAATTTCCTTTTATAATTACACTAATACAAATTTTTCAATTG
AGAATTTGGCTTAAGCAGGATTGGTAAATATTCACGATTTACAATAAAACCTTCGTCATT
TCCTTGATTATTATACTCCTCTTTAAATTTCAAAGGCTTCTAATGTATAAGATATTTAGA
AATAAATCTAAACTCAATTAGAAGGAAACAAGTAATATTTTAGTTGATATCATCTATTTC
AATTTATAAGTTATTTTTATATTTAAATTAGCTTTGTAAACGGATCTTTAAATTTAGACG
TTGGATTAGATGTAACTGTGAATTCAATGTCCTATTAAGTTCATAAAAATAGCAAAAACT
AAATAAGTGACAAAAAAGTTAAATTTATAAAGCCTTAAAGAAAATACCTTAGTAATTATA
TTTGTTCTTTTGATTCAGAAGGTTGTGTTAACATCTGGAATACAGAATTAAATCTTCAAA
GAGTCGCTATTTCTGAATTTAAAAAAGAGTTTGTTTTTCCAGTTGAGTGCTAAATTGGTA
ATGATCTTCGTAAAAATGAGGAAGAGCTTAATAGCAAAATGAACGAAGCTTCCAACAGTT
CAAATTTCTAAAGTTAACTCTATAAAATTCTTGAAAATTCCATATCTTCATAGTGTAAAT
ATGCTAAGAAGCCTAAGCCTATTGAAAAATCGATAGTAGCAGACGCAGAAATTATTGAAA
AGCTATTAAATTATGTATTTTTTTTAAAGTTAGATAAAAAATCTAATTATATTTTTTTCT
AAATAGGGTTTTACTGTTAATGTTGCTAAGAAAGCTTGCATTGAAGTTAAAAACGAGAGT
GTTGAAAAAGCATTAGATGTTGCTTTAAGAATACAACAAGAGGAAAATAGTGAATTAGAA
TAAAATAATCAGAAGAGCTCACTTTTCAGTGGTGATGATGAAATTCATGTTAATAGCATA
AAATAAGAGTGGTCATGCGAAATATGTACTTATTAGAACTTTGGCAGATTCTAAAAGTGT
GAAATGTGCTTTTCCCCTGCCCCTGAGAGTGCATATTACACAGAAGAAGAAGTAATGGAG
ATTATGCAAGAAAAATTGCTTTAAAAATAGTTAGAAGAAGAAAGAATATTGAAAGAAATT
CAAAGAAAAGAAGAAGAAGAAAATAGAATTAAAAAGGAAACTCTGGAAAGAGAAGAGCAG
AGATTAAAATAATTAGAAGAAAATAAATAAAAAATGAAGGCCTTCTTAGAGTAATCTGAA
GCTAAAAGTGGATTCTTATTAAATTTAAAATAAAATTCTTTAGCCTAACTAATCGCTGGT
GTTTCATTTAACAGCTAATGTGGTAGCGGTGTCTCTTAAAAGAGCTTGCTTCGTATTAGA
AGGTTTGCAACTAACCCAAATTTACTTAATTAATTTTATAGCTTAACCTCGAAGGGTATT
GTTTGTAATTTAAATGGCTAATATATATAAGAAAATACAATTAACTCACTTGAGAGTATT
CTCTTTTCTAATGAAAATAATCGCTATATTTTTGAAACTCTTTCACCAATAGCTACTGAA
AATTCAGATTTACACAATTTGCTTGCTGTGTCAGAAGCTAATTTATAGTTTGAAGAAGAG
AGCATTATCGATTGCAGTTGGAGATTAATTTCATAATCTTCCGAGAACGAAGTAATGATT
TTATTAATTTTTTAGCCAATTTAATATTTAAATATTAAAATAGACCTATGATTTATTTAT
CTTGACATGCTCCTCAAACAATTAATTAAATTTGCATTAATATAAAATGGTTTTTGATAT
CCTCGATCCCTATAATCTTTAAAAGAAAGAAATTGAAACATAATTCATTAAAAAAATTAT
AATTAGCACTTAACAAGAAAGAACCGAAGAAGGTCTTATTGTACTATCAGAAAAAAGCGA
AGTAGTTATAGTAGTAATTTAAAATAAAATATTCTATATCCCTATAACTAAATAAGTTAT
GTCTAATGAGATATAAGTAAAAGAACTAAAAGGCAGTGCTGAGAACATTAATTTAATATT
ATCTGGCAGTCTATTTATTACAGATAAAACATAAACTCTTACTATTATTAATATACCCTA
ATAAATAACTGTTTAACAAACATAGCCTAATCAAATTGAATAAGATAGCCAAATTGATTT
ATATAATACAATCAATTTCACAGAACAATAGCTTAAATTTTTAAAATAATAACTTTAATA
TTATCAAATAGGCACATTAGCTAATAAACTCTCCTAAAAATCTGAATTATATGATTCATT
TTCATAACTCAATTCTAAGCATTCATTTAATTTGAGAAATAAACATAAATTTGAAGTAGA
ATTTTAATTATAGAATCCTTAATACTTGTAAAGCATTCTATTGGACTTCAGCCTAGTCTC
CCCTTAGAAGGACGCAAAATCACTTCTTCCACTTACAGAGTAATTTTTACTATTTAATAA
ATAAATAAATTTTATTTATCATTTTAAATAAAAAAACACTTTAGCTGTATCTTAAAAGAA
AAAGTTGATCAGAATAGCTTCTTTTCTTTTGATACTTGGGAGCCTTAATCTCAACCTAAG
ACATCATAAAATGGAAACTCAAATTTAAATTTAAATGAAAAATCAAATAAATACTTACCT
TTATCTATTTAACTTTGCACTGGAACTCCTTATTCATAAAAGCATTAATCTAGTTCAATT
TTATTCCCTAATTAAAGTTCATTCTAAAGCTTTGATTAAAATTGTTGCTTCCTGGTAAAA
CATCTTCACAATAAATATATTGTTGCAGATTCTGTAACTATAGAATCTTACGATCATCCT
ATTGAAGGAGGTTATCCAGTAGGCACTTTGTTAATTTTCACTGCTGATCATCCATCTGTT
ATTGAACGTGCAGCACACCAGTTTTCTTAAATGACATAAGCAGAATACGATGAATGGAGA
GAGAAAAATCAAGGTAGAAATCTTGAATAATGGGAACCTGTTGCCTGTGTTTCATTCAGC
GAGTCACAAACTATAAAAACTGTTAATGTTGACTACAAAAGGTAAGCTTAAATTTTCAAT
ACTTTCAAACAAATCTTTAAATATAATTTAATAAATTAATTAATAGGTGTTCAAAGTATA
TTTTAGTAATGCCAACTTCTCTTAGACAAAAGTTCAAGCATTTAACTGGAAATCAATGTA
CATCTTATTAATTTGTTGGTGTTTAAGGTTTTGCTCTGAATGAAGTTTCTCAACTTGAAA
ATGGCTTTAATTTGAAAAATTCTAGCTCAAGTGAAATCTAATTTATTTAAAAATATATAA
ACGAAAATGTTACAATTGAAGTTAAGACTCAGCAAAGTAATGAGTGGATTGCTTTAACAG
AAGAAAAAACTAGCATATTCTTAAAGAACTTTGCTAAAAACACTGTAGTACCAAATTATA
AATTAAATACTTCCATAGTAAAGCGCTTAAGTGATCTTGGAGAAGTAGCTAGTTCACTTG
CTAATTCTAGTGATTTGACTCTTCAATTTATTTCTGAAGATATTTTCACATAATCTAAAA
TATCATAAATTCGCATTAAAATAGCAAATAATTAAATAAATAATTTTAATTAAATTTAGT
CATTGGGATTCACTGTAAAAGGTAGGATTTATGGTGGCTCTGGTCAATCTCTTTCGGAAA
TATAAAATAATATTTTATTAAATCCATCTTACTACGAAACTATAAATGGCAAGATAGTTA
GCTAATTAATCGCCCTTTCTTCTGCTTCTTACAACTAAGCAACTAGAAATTTAATAGAAG
CAGCATCTTAATATTTAATTTAGGTTATGTCAAGTTCCCATAACTACCTTCTTAATGACG
ATATGATAAACCTCATTTATACTAAATTTGACTTAGAAAGATTCATATCTTCAAATATTC
TTTAAAATCCTACTCGTAAATTCACTTACTAATATAACCTATTGAGAAGTTTCAGCAGAT
GCACTGGCTTTTAACAAAAACTTCTTAGCGCTCTTCTTAACCTTCTCCCTTAAATTACAA
CAAGATAAATCCCAGTCACTGAAAGCGGTTTGAGCATTTATTTAAGTCTCTTAAGATGGT
GTTAACCTTAAAACGCTTCTAAAATATTCTTACAATTACTCAATCAACTTCATATAATTT
CTAAAAAAGTATAAGAGAAAAAAGATTCCTATTATAATATTTTGACTTCAAGATTTGACA
TAAATACTTTATGCTTTGAAAAAAGTCTTTTCAGTGAGTTATTCCTTTCCAAAGAATATA
AATATTCCCACAGTAATTTACAAGCAAAAGATAATAGCTACTTAAATTCTAAAGTTTACA
TCACTGAAGATGTATTTGTTCACGAAATTTATATTGATCTCTAAAAGAAATATAACTTGA
ATGAAATATCCTTAGCATTTAATAGAAACTCTATTTATTAATCCAGTTTTAGAGTGATTG
TTTGGAAATTTTAAAATAATAAGTAAGAAATGCTAGTAGATGAATAATATGGAAGTGAGA
CTTTCGTCTAGTTGTCTAACTACTCTCATGAAAGTTCATCTTTAAAATAATTTTAAAATA
GAGAAGAAATCTCTACTTTGAAGTTGCTAGAAACAGCGGAAACCTCTTAAGTATCTTCAC
GTTATCTTATTATCTAAGTAATTTTTTTTAAATAAAAAAATAAATATTTTAACATATATT
TTACTTAATTTTAATTAGATCAATTTTAGTTTGAGACCTTTTATAGGTACTTCTAAATAA
TTGAGTGATATTCCTTTTTAGAATAACCATTTTAGACCATTAATATAAGGTGTACTTTCA
TAGGAAGAATCTAATGAATAAATTCCTTCATGTTTCCCATAAGATTTCGCTTCCTAATCA
GTTGGCATTGATGCTGCAGGTGTCACAAAATCTAAAATCGATGCTGCAGGAGTCACAAAA
TCAAAAACTGATGCTGGAAATTCTTAAATCAATAAGGAGCACTAAAGTTTAGCTATTCTT
GATGAAATGCAAAATAAATTAAAAGCTTTACTCACAAATGAAGAAGCCCATAGAGACATT
ATAATTAAATAAGTTATTGAAATAGAAGAGGTATTAAAACAAAATTATTTACAAGAAAAC
TGTAGAAGGTTTAATAATACTAATTAGTAAGCTGCACTTTCTAATGATTGCAATTTATCA
TATCTCTACACATTAGCTTATAGTTTTTCACAATTTTTAAGAAAAATTAATGAAGTCAAC
AACAATTCAGAGGATAAAAAGAATAATTAATGGATTAATTCTGCTACAAACGGAAGAAAT
AATATTTTCCATGATGTGTTTGAAACTTTTGTAGTTTTTGATAACAGTTTATTATCATAG
GAAATTCTTACCCTCCTTGGAGAAGTTCTTATTGATAACTTAAGTGAAAAGGAATGGTTA
TAGTTTGTTTTTACTATTCTTAAAAGATATTTGATGCAACCAAAGTAAGCCACACTCCCT
ATAAACTAACTCTTCTCTCAAACAAATCTCATCAAAGCTTTAGACAGGATTTCTATACCT
CTTGGAGAAGTATTGGCTTTCTTAGCTACCTAGTTAAACATTCCTATTGAAAATGTCATA
CTTGAAACTTAAGAAAGAGAAATTTCTTATGGATACCTTGCTCCTACTTTAGCTCTGTTA
TATAATGGATTCAAAAATATTCCTAAAATTAGCGTAATTAAATCATCATTTTTAGTTTTA
AAATTTAGTTTATTTTTATTTTAAACAGATTAATTAGAGAGCTCAAAAAAATAAGGAAAA
TACAAACAATCAATCTGCTAATCCTAATAAGTTAGCTTAGGTTTTAGACCCAATGAGTTT
AAAGCTCACAAAAAGTGTTTCTCGTGAATTAGAAAGAATAAATAATTAAAAAATTGTAAG
TTAAGACCAAGAATAATCTTAATAAAATAAAATCAACTCAAAAGGATAGAATTCTGCTTA
AAAGGAAGCAAAGTAATCAGATAAAAATGAAGAAGAGGAAGAAGATATTTTTATTGTCCT
TCCCCCTGCTGGAGTAAAAAGAAGTGTATCTCACCCTTTGAAAAATGAAATCCAAAAGAG
ACAGTTGCAAAACGAGTCATAATTGCTAACATCTATTGAAGAGCAAGAAGATATTGTAAG
ACTTGATTACGATGAATCTTTCAATGTTGCATTTTAAGTTTGTGTTTGGATTGTCGAGCA
CAAAAATAAGTTTGATAGCCAAGAGGAGTTCGTTTAACTTATGAAACTATGCTTCAATCT
TTTAGAATTAATCTCTTCCTTGTCTTCAATGAATGGAATTAAGAGAACTCTACTAGCAAA
TTCTTTTGATAATAACACCTTCTTTAAGCTTTATTTCTATGTCCTTTCTTCAGGTCACAA
AGAAATCATTGCTCTACTCTCTCATTTAGTTTTATTATTATCCAATCCTCCTTCTTTCTC
ATAGATAGATTGGGCTTCTTTGAATGTAATTTTATTTATTTAAATGTCAAAACTTTTTTA
AAAATTTGCATTATATCAAACAGAAGGAAGAAAGAAGCTTCTTACTTAATGAGAAGTAAA
GCTTAGAAGAAATACAACTCATATTGGTCTTCCAAATTGAATAAATTATGTAGTGGATGC
TTGAGTACTCTATGTATCCTAGTTCTTCAAAAAATAACTTATATGGCATGATTCTCCAAA
AGGAAATAGATTCAGAAGAATGGTCATCTCACTTATAATTTACTATGCAGCTTCTTCTTG
AAGTGAATAAAACTTTGCAAGAAGAATTTAAGCATAAATCCTTTTTGGAAGCCTCTGCAT
CGAATCTTAGAAAGGGATCTTATGACTAGAATAGAAGAAGATAGCAATCAGCTGAAAGAA
GAAGCAAGAAAAACTCTTCTCCTAATTAAAATACAAATCAATCCTCTCAAAAAGAAGAAA
ATATTGATGATGCAGGTGAAGTTGAAGATGAAATAGCTGAAATAACTTAAAAAACATTTA
TGGCTACATCTCACGATCCTTCTTAATCTGTAGGTAGATAAATTTCTTAATAACAACAAC
ACAATGCTAATACTAACGATTTGGTCCCTGTTGGCATCTCAAGATCTTTGAGTGTCCCAA
TTAATAAGCAGCAAATATTAACTCAATATACTAAACAATAAATGCTGGAGTTTGTTGATA
AAAGCATCAGTGAGAGATCTTGCTCTCTTTCTTTGCGTACTGCTATCACACTCATAGATT
TAATAGAAGCCTCTTCAACAGGTACTTAAGCTAATTAGATATACAACTCAAATGGAAAAT
TGTTAAGCTTTATTGATAATGCTTAAATATGGACTTTGCTATTTAAATTCATAGAGTAAT
TAAAGCTCAAGTAAATACTTTCTTCAAAGCTTTTTGAAAGACTTGCTAATCTATTCTTTA
ACTATGAATTTTTAACCTCTAAGACTCTGCAATAGATGCTTCTCTCAAAATCCTATGATT
TCCTTATGTTGACACAAAGTCTTTTTAATAAAATTACAAATGAAACTTAATCTCCTAACT
TCCCACCTCATATGAGTGCTGTCCTAAACAGTCCTACTTTAGCTAGCAAGAGAGAATCTG
CAGTTAAAGACCATAAATAATTCTGCTAACTTCTCTTGAATATTATTTTTGAACAGCTCA
TCCCTGGCTTAACTTTAGAATCAACAATTACTTCCAGTCTTCCTTCAAAGAGAATATTTG
TGTAAGACATACCTCAATAAATATCTTCAGTAATTGCTAAAAAAACAGGTATTTTATAAA
CAAGCTCAATCCACTATTTTATTATAAATGGATGGCTTGATATACTATTGACAAAGAGTA
CTCCTAAACCAGAATCATACTACACATAACCTTAAAATGATGTATCATACTGTAAATTAA
GCCCTCTAAGCGCAGCCTCTCTATTAGTGAATATTAGTTAATACTTATTAACTCATTGCA
ACTTTGGTGGTTTAAGAGGTATTGAAATTTCAGACCATGAAGTTCTCATTAAATTATAAA
TTATTTCCATTCTAATATAAATCTTTACTCGCTCTTAAGTTTCTCCAACTACTAATACCT
GCCCTTCTACTTCTTAGCCTTAATGTTTGAAGGAGTTATTTACAACATCTGATTATATTA
TCTAAGAAAAAATCACTAACAGTCTTCAAAATTTAATAAAGTGGTACATCTTTAACAAGG
TATATTTTTTTAAAAATCATATAATTCATCATTTTATTTAATATAAAACTTAATAAATTT
AATAAATAGAGTAAAGAAACAAAAAATTCACCTTGTTCAGTTAGCTTGTCTTAAATTAGT
TCATAAGTTATGAAGATCTTTGAAGCAACAACTGAATTTTAAAATATTGCAAAAATCTTC
TTGAATGAATTAATTGTTGTTTGCAAAAATTTAGACAGAGTAATGAAAGAACAATTTAAT
AAAAATTAGATCAACGTTTTGATTGCTTAATAAATAACTGATAATGCTTCTTATTTATTA
GAAACTATGTTTGATTTGTTAGTTTGTAATGACGAAATTGCTTCTTATGTGTCATTTTAA
GTAAAGGGATTCTAGTTCCTCTTAGAAAAGATGGGATTAGAAAAAGTATAAAAAGCTAAA
AGAGAAAAATTGACAATGCCTGAGTGTAAGCCAGCTTAGGAATCTAGTATAATTTGTGGA
TAAATTATACATAAGAATCCAAAGTATGAAATAGCTTCTTACATAGATTCATGCATTTTA
GGAACATATTAATAGTCTCTCTCATAAGAGGAAAATGATAAATAAAACAAACTACCTGCA
AACAAATAAGCTAACCAATAAAATAAAGAGTCTAGCGCAATATCTTCATCAGCTCCCAGT
AGCCTTCTTATCCATAAAATACTCCCTGAAGAGTAGTGCTCTAAAGCTACTCTTATAAAA
ACTCCAGGATAGACTTGGATTAACAACCCTACAAATTGGAGTGAATAGAAAAATGGAGCT
CTAAATCATAACTTGATATGGACATAAATGAATGGAAAACAACACTCAGAATGTTATTTA
ACTATTGAATTAGAAAATAAGGTATAAAAATTCTATTCAAATATCTATTTTACTTATTGA
ATTAACTAAATTTTATTTTATGTTTATTAGGTCTTCTTATCAAGCATTAAAATTGGCTTT
AACTTGTACTGGGCTGACTATGAAGATAAAGTTCTTGGTATTCCATCAAGCATTTTAGTA
GAATACACTAGCGATCTTTCTATACCCTTCAAGCCTCTTACTCATTTATCTACAATTTAA
GATTAAGGGTAATTAATTATTCATTAAATTTTTATAAATTTAAGTTAATTTATTTTTTTA
ATTTTTTTAAATAGATATGAAAACTTCAAAGTAAAAGTAGCAGCCAAAAACTTTGAAAGA
TTAAGAGAAGATGGAAATGGTGATGTTGAAAAGCTTCTTAGGGCTAACTATAATTAAGAG
GTTAAATTCTTGCGCTTTAGATTTACTCGTCCTATTATCAACTTTATTGAAAATGGATCA
GTATTATAAACTAAATTATTTGAAAATATTGCTATCTCATTAAGCTTTATTAGTGTCATG
GGTTACCATACTAATATATTGAACTCCTAATAAATAACAGAAAAGGTTATTTCTGAATAA
GAGTCAAGTGCTATTAAGCTTATCGGAAAACTTTGCAATTAGTCTTTCTCTTCAACACTT
AACTTGATAGCAAACAATGAATCAATATTAGATAAAATCAAACGCCACTTTGAAGTTATG
AGTTTATTATTAGTAAATCATGAACACTGCTTAGCTCCTGTCTTCTTAGCTATTGCTGGA
AATAACTAGGAAATGGGTGATTGGATTCTAACTAATTTCCTAGATCTTAATAAAGTTAGT
TCTCATGCAAAGATGGTTAGCGAAATAGTATGCTCTTAGCTTTCTCATACTCATAAGAGA
GTTCAAAAGGTTCATAATTTTGTCCTTTAATCTGCAGTAAAAGAAATACTTACTCTTCAA
GAAGTATCGTCAAACCAATATCAAGCAGCTTTCCACTTCAATGCTCTTTTACCCTTCGCT
GAAACCTGGGCAACATCTATCCATATAAGCGCTTTAGATTTTAGCACTTAAAATCATCTT
GCAAGTGCCAGTGGGGAAAGTAATGAAAAATATAGCAAATTACTTTTGCCTGTCACTCAA
GAAATGATAAACAACCTTATCAAGCTGTATAAAATTTTCTACTAAACTTCTAAATACAAA
TTAATAATAAAAATCATAATCACTGCTCTCAATTTACCAAGACCTTACGTTATAGCTGAA
AATATATCATATGAAGAAGAAAAAGTTGTTAGAGAGAATCTTCTCCTTAACACTTTGAAT
GAACTATGGGCATAATCTAAAACTGATTCTAAGTATCTAGAATTGATAGCTCCTCTCATT
TTAAGTAATTAACGCGGAGTTGAATGGCTTCTACTTGACGAACAAAAGAAACTTTTGTAA
ATGTTAGGTTAATTGCTTAACTTAATTAAATAAAGCAACTCAAGCCAACAAAATATGCTT
ATTGACTATCTTAACTTCTTAAGTGCAATCACCACTAATACTACAATCTAAGAAGCTATA
TGCTCTCAAAAAATGCACATTAATTTCTACAACTGCTTAAAAGATAACAATAAAAATTCA
ACAAAACTTATAAAAACATTCTAAGACCCTCACATGATTTCAATTATTGTTGAAATTTTG
AAAAATGTAGCCTTGTCGTCTCCTGAATAGGCTAAAATCTTCGCTAAAGTGTTGAGTGAT
GATATAAAACTACTAACTTCTAAACGTGATATGATATACGTCACAAACCTTTTGGTTCCA
TTACTAAATTCTGAGAAAACATTGTCTGTTGCCTTCCATCCCTTCGATAGCTTTAGTAAA
TTTAAATTTTAAATTATTTATTTTATTTAATATTTTTTAAAATTTTAAAGGCAACAAATG
GCTTGCAGAAGGTAAAAAGATCCTTGAATACAAGAGAGACAGAAAAGGATAATAATTACC
TTAAGATCTTTCAAGTAAATCTGCATCAGTGTTATCTTCTAATTTAAAGAGACCAAATAG
CATTCCTTCATTCGCAACTCAACTTGGAAAGAAAGAAGTTGTTAAAGGTATGTTCCCTTG
CTGGGATACCTTAACTCAAAGTTTGACAACAAAATTACTTTGGAATGATAAATAGCGTGA
AGCATTTAATAGAAATATTGAATTATTTACTAAAAAAACAAATTTATTCTCTCAACTTTC
GCAACCTGTAAAAACTTAGGAGACTGATCCCACAAAGAAATTACCATAAATGTGCTATTA
ATGGTAGCTTGTTTAAGTTTAAGATAAAGATTGCGATCCCTCTATGCTTGAACTTGTTAA
AGAAAATGTTTTAAAGCAAGGACCATTCTTAATTATAATTGAAGGCTACAATTAAGAACA
AAAATGCGTTAGCGGTGTCTTTAGCAGCCAAAGTATCTAATTATAGAAAGTCGAGACTGA
GTCTGGAGAGGCTTAGATTATTCCTCGCGCTGATGATAACTTTATCTTTTACTATGAAGA
AAACTTCTAGATGCATTTCGATGTACCACCTGACAACAGCAAGCAGTTTGGTTCGTTGAT
GCTTATCGAAAAAACTGGAGCCGGACTTCAATTCTAATATCTTGAAAATGAACGCATATT
CATCAGTTATTAATAATAAATTCCTTCAGTTGTTGATATAAACTTACAAGAGATGACTCC
TATCGACACTGATACTAAGAATTTCCCAAAAGATGTACCTGCAGAATTCGAGCTAACAAA
AGTTGAATATTGGGTCCTTAAACCAAAAGAGATTTAATCTAGTTTGCTTTTTTCATAGAA
CACATCAAAGCATGCTAATTCATCTTCATTCTTACAAAATCTTCATAACAATTTACTTTT
CTAATCTCAAAAGTAATTCATTTAATTTGATTTAAAATAAATAATTTTATTATTTTTTTA
TTTAGCCTCAGCGCAAGTAGCATAGCCAACTACTATAGAGCTGTTCCAGTTTATTATATT
CCAGAAAGTTTAGACATTGAAAAAATATTAAGCATGGTAAATGTTGGTGGTTTCTGGTTA
AGCGATGAAGGAAAGAATACTCTTAGCTTTAAACTAAGACAAAATAAGAAGCATTAAATT
TAATTGAATACCAAGCTCGCTGAAATAGCTAGTGAAGGAACAAGCTCAGATGGAGTTATA
GATTTAGAGTTCGATGCCTTATAACTTTATGAAAATTGCACAGAAATAACCAACCCATAC
TTGAATCCACTCACTAATAAGGTCGACTATTTACCTATAATGCCAATATTTGAAATGTTC
TCTCAAGAAGGAGGAATATAATAAATTATAGAAGTTATTTAAGCATCTTTGAAGTGTTGG
AAAAATACTGAAAGAGCTGGAAAATGGGAAGTCTTTATGAAAGAACTTAAAAAATTCAGC
TTACTTCCAAATTACTTTGGACTCTTTATGAAAAACAAAGATTGTATCGAGTTGTTATTT
GAACTTTTAGCAGGGCTCCCTGATGAAATACCTTCATAAGACGATAAAAATAAAAAACTT
TCAGGAGGATATAATGTTCCCCCTACAACAGGCACTACTACAGTTACTTCAACAACAACA
GCAACAACTACCACAACTACAACTACAGCCACTACAACTGCTTCTGGAGCTATTAAAGAT
AAATAGAATGCTGCTGGATCTAAAAAGTGGGATGAAGAAGAGTAAAAAGCTGTTAATTAT
AGTTACCAAGTGCTAAAAGATACATTTAAATTAGGATAAGATAATGCTGTTAGAGCTGCT
GCTCTAGAACATGGACTTATTGAAGCCATTCTTGAAAAAATAGCTTAAACTTCAAAAGAA
ATAAAGAGAACCTTTGTTGCTGATTCTACCTCAAATGAAGAAGAATAGGAAGATAATAAT
TTAACACTCACAAAATAAGCTTCAGAAGATGATGGTAAAAAGAAAATTGTACAGAAAAAA
GGTATCGGTTATGGTTCAGACAATACTGGATAAAACCAAAAATGGAATACTAATGATTAT
ATAGAATCTAAAAAGGCTAGATCTGAATCTCTCAAGAATCTTGTTGCAGTTTTAGTAAGA
AAAATCATATTTTTTTCATTTTAAAATTAATATATTAAAAAATTTTTTTCTACTTTTAAT
AGGAAGCATTTTTGGACTTCAAAAACTGGGAACCACCAAAATTGTTAGTAGAATAACTGA
TGTCAAGTGCTCTATTACCTTTAGTAGAATCATCTTTAAGAAGTGGTTCTCTATTAGAAA
TGTCAAAGGATAAAGAATTGGTTTTCACTTATTTGAGTTTGTTGAGAGTCATTGCTAAAA
ATAGTTGTTTAGTCCCTTGTTTATTGCCTCTTGATCCTAGATATATTCCTAAGCAAACTG
AATCGGTACTCTTCCTTATTGGATAATTAAAGGATACTGCCAAAATTTTCTTAAGTTGCA
TGACTGCTAAGACTGATAACACATCTTCATAACAATAGTAAGAAGAGACCGCTAATTCTA
AAAAATTAGCTGATGAAATTCTTTTAACATTTGAAGCAATTAACGACGCTTGCAAGCATT
ATCAATAAGAACATGAAGAAGAAGAAGATTTAAACAGCTAGCAAGATGCTATCAATTAGG
TATTAGAATTACCCCTACCTTAAAAATATAAAATATTACTGTAAGATTTGAGGTTCGATT
ATACTTCATTCAAAAATGAGCAAGGAAAGTATAAGCACCACTACTCTTCAAGTATCACAA
CTTCTTATACCCCTCCTTAAGCTAAAATGGTTCGTCTTGCTTAAGAATTAGCAGATTTAT
CAACTGCACTTCCTATTGATCATACAAATTCTATATTTGTTAGATGCGATACAGATAGAG
TAGATGTAATGAAATGTATGGTTATGGGTTCTAAGGGAACTCCATACGCACACGGAGCTT
TTATTTTTGATGTATACTTCAGTGATGAATATCCTAACTAGCCTCCTAAATGCAATCTTG
AAACAACTGGTGCTGGTAAAGTCAGATTTAATCCTAATTTGTATGCTTGTGGTAAAGTTT
GTCTCTCTCTGCTTGGTAAAACTTATTTTCTTAAATTAAAATTAATTTTTTTTTTTTATA
AAGGTACTTGGAGAGGTAACGCTAGTGAGAATTGGGATCCTAAGATTAGTACTTTACTAT
AAATTTTAGTTAGTTTATAAGCAATTATTATGAGTGAAGAAGTATATTTCAATGAACCAG
GATTTGAAGGAGAAGCTGGCTCTGAGGAAGGAGAGAGAAAGAATGAAGCTTATTCTAACA
TCGTTAGATATTGCAATATTAAATATGCTATGATAGATTAAATTAAAAATCCTCCTGAAG
GTTTCTAAGCTGTTATTATGAGACACTTCTACCTTAAGAAGTAAGAAATTCTTGAAGAAT
GTTAAAAATGGATTAAATACGCAGATGTAAGATAGGCTTCTTATGTTGGCTTAGTTAATG
ATCATAATAGCTCATGGTGTGCAGAATTCAAAACTAAATATCCATAAATGTTGCGTGAAG
CAGTTACTGAACTAGAGGAAGTTCTTAATTCAATCCCACCTCCAAGCGCTTAAGAAACTA
AACTTAAACTTAAAAACATCAAGAAGAAACCAAAGAAACTTGAAAAGAAGCAATAGTATG
ACATCACTTAAGGTGTTGCTAAAATTGACGACATTGATGTTAAGTACGATGATGAAGTAG
AAGAAAAGAAAGAAGATAATAAAGAAAAAGATTTTATTGATATTAATGATGAAAAAGTTA
AGGATAGATGGAGCAGATATATTGGAGCTATGGGTATTGATGCCGTAGCTAAATAGTCTA
AGTGTTCAGTATTCTTGAGCGGTTTAGGCTCTTTAGGTGTCGAAATCTCCAAGAATTTAG
TCATGAGTGGTATTAAGAGACTTACTATACATGATTCTAAGAAAACTTAATTCAGTGATT
TGTCAGGTATATTTATTTACTTTTTTTAAATTCATTTTATGGAAAAATTTTATTAAATTT
TTAGGACAATTTTACTTGGGAGAAGAAGATATTGGTAAGAATAGGGCTGAATAAAGCTTA
AAGAAAATCAGATAACTTAATCACTACGTCAAAGTAGATACAGCAATGCTTGACAAAGAG
CTTCCTGAAACTGAAGAGGGATTAAAAGAAGACTTAAAATTGCACGATTACAATATTGTT
GTTCTCACTGAAGTGCTTTCTATGAAAAAATAAATTTTAATCAATGAATTCTGCCGCTCT
AGAGGTATTAAATTTATTAGTGCTGATGTTTTAGGTCCTTGGTGTAGACTATTTAATGAC
TTTGGGGATAAATTCGAAGTCATTGATAAGAATGGAGAAGATCCTTAGGAAGTAATGATA
AAAAATATAACTAATGCTGAAAAAGGTGTTGTTACTCTGCTTCCTGGAGTAAAACATCCT
TTTGAAGATGGTGAGCATGTTATATTCTCAGAAGTCTTGGGAATGGAACTCTAATAAGAA
AAAGGAAAAGAAGAAACTTAAACAATGACTATGATGGGTGGAGACGAATCTTCCAAACCA
TCAATTAATAGCACTATTCATAAGATTAGAGTAATTAACTCCAATTCATTTGAAATTGGA
GATACTAGAGGATTTACCAATTACGTTAGAAATGGTATCGCTAAAAATATAAAAACTCCT
GTTAACATTTCCTTCAAGAGTATGGCAAATGTCTTTAATGTCTCAAAATTAGATGAAGTT
CCTTTTGATCCAAATTTAATAATTCATGATTTTGAAAAAATAGAAAATCCTCATATCTTA
TTCTTAGCATTTAAAGTACTTGAAGAATACTAAAGTACCCACAAAGGATGTTTACCACAG
TGCTGGAACGCTGATGATGCCAAACAATTCTTGACTTTAGCAGAACCAGTAATAGCTAAA
TATTACCCTGATTCTTCCTAGCAACCTAAAAACCTTAAAGAAATTCTTTTACGTTTTGCT
TTAACTGTTAATAGTAATGTTGGTCCATTTGCAGCTTTCTTAGGTGGTTTTGTCACTCAG
GAAATCGTTAAAGCAATAACTAATAAGTATATTCCTACTTCTTAAGTATTTTTCTCAGAT
TGTATGGAAATCATTCCAGAAAGCGGAGATCTAAATATCAATAATTACGCATCTTATATA
GAAAAGAATTATGCCTTAGAGTTTGCTCCTACTAATGACAGAAATGATGGTATCCGCCAT
GCTATCGGAAACACACTCCTTAATTAAATTAAATTCTGCAATCTCTTTATGATTGGATGT
GGTGCTATAGGATGTGAACTTCTTAAGAATTTTGCTATGATTAACCTAGGAACAGGCGTT
GATAAGCAAAATGGAAAAATAGGCTAACTTACAATTACAGATCCTGATCATATTGAAGTA
TCTAACTTAAATAGATAATTCCTTTTCCGTGAGAAACATTTACGTAAGCCAAAATCATAA
ACTGCAGCAGCATCAGCTATTCAAATGAATCCTCTATTAAAGGATCACATTTTAGCTCGT
TTGGATAAGGTTCATGATGGAACAATCAATATCTTCTCTGATAAATTCTTCTCAACTTTG
AATGTAGTTGCCAACGCACTTGATAATGTTTAAGCAAGAAGATATGTAAAAAATTATCAT
TTTTAATTAATTACTTACAAATAAAAAATATAATTACAATAATAAAAAATTTAAATAATA
AATAATAGGTTGATTCTAGATGTGTAAGTAACAAAAAGCCTTTGTTAGAAAGTGGTACAC
TTGGTCCTAAGGGACACGTCCAAGTAATCCTTCCTTATAAAACTGAAAGTTATGGAAGTC
AGTAAGATCCTTAGGAAGAGGGAGAAATACCTCACTGCACTTTAAAGATGTTCCCTGAAG
AAACTTTACACTGTGTTGAATGGGCTCGTGACAAATTTGGAAAGCTATTCACTTTGAGAC
CAAAGAGCGTAAATAAAATCTTAGAAGATTCTAATTATGACCCATAAGGTGGACAAGAAT
TAAAGGAATTCAAAGAAGCAATAAAATTATTAGAGAAGAGACCCCAGTCATTCTCTGATT
GCATTGCCTATGCTGTCAAAAAATTCTATAAATACTTCAGAAACGACATCTGCTAACTTA
TGTACACATATCCTATTGATTCAAAAACTAAGGATGGCGAACCTTTCTGGAAACTCCCTA
AGCGACCTCCTACTGATATTAGCTTTGATCCTAATAATTAATTACATCGTGATTTCGTCA
CTGCTTTAGCTGTTTTACGTGCCAAGATATTCTAGGTAGAGTATCCAAAGTCATTTAGAA
CTGAAGCTGAGAAAATAAAAATTGCTTAAGAGGCTAGTATAGTAAAGATAGAAGATTTTA
AACCATCAGAAAATAAAGCCTAAGCCATTTCATCAGAAGTAAACAAAGATAAAAAAACAG
ATGAGAATGATAAAGATGAATAAGAGGCACAAGAAGAAGACCAACATTCAAATAAGATAA
TGGATGAAGTCGCTGAAAAGGCTATGCTCATGAAAAAGCTCTCTGAAATTAAGAAAGTTA
TTCCTGAAGAGTATTTCAAGCCAGTAAATATTAATTATTTTTTTTATATTTTGTTAAATT
TTTTGGATTAAAAAGAATACTGAAAAGCACCTTTTACTTGCAGAGGAATTTGAGAAGGAT
GAGGATGATAATGGTCACATAGATTTAATTTATGCAATGGCTAACTGCAGGTCTACTAAT
TACAAACTTGCTCCAATGGATTGGATTTAAGTTAAGATTAAAGCTGGCCGTATTGTTCCT
GCTTTAGCTACAACCACTGCAACAGTCGCTGGTTTGCAAACAATAGAATTAATAAAAATA
TTGAAAAATGAAAAGCTCAGTAATATGAAGAATGCTTTCTTGAATTTAGCTGTCCCTCTC
ATTCAACTCACAGAACCTTAGAAAGCTGAATAAATTAAAATACATGAAGAGTTAGAAGTT
ACACTTTGGGATAGATGGGAAGTGTCCCTGGGTTAAAATGTAACTCTAAAATAGGTTTTC
TAACATTTCGAAACTAAATATAAGCTTAACGTTTGCGATATAATAAGTGGAAGCAAACCT
ATTTATTTAAGTACTGTGATGGACATAGCAGGAAAAGAACATGAAAAAGAAAAGACTTTG
AATAGCCAAATAACCGATATTATTGAAGTCGAAGTAAATATTTATTATATCTAATTACAT
CAAATTAATTAATTTTATTAACTTAAATAATAGGATGATTACATTGATTTAATATTTACT
TTCTCAAATAAGAAAGGAGAAAAAGTAAAACAAACTCCTCTTGTACGCATTTAATTCAAG
TGA