Identifiers and Description

Gene Model Identifier

TTHERM_00481290

Standard Name

UBA13 (Ubiquitin-Activating enzyme; UBA1 ortholog)

Aliases

PreTt06261 | 58.m00233 | 3719.m00089

Description

Ubiquitin-conjugating enzyme family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00899 ) ThiF family
  • ( PF07813 ) LTXXQ motif
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR01257 ) rim ABC transporter
  • ( PF00179 ) Ubiquitin-conjugating enzyme
  • ( TIGR01408 ) ubiquitin-activating enzyme E1
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR01866 ) CRISPR-associated protein, Csn2 family
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( PF02134 ) Repeat in ubiquitin-activating (UBA) protein
  • ( PF05743 ) Tumour susceptibility gene 101 protein
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00481290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14215.19.997093137033517e-262ubiquitin-conjugating enzyme f
amily protein (2687 aa)
OxytrichaContig20846.0.g999.997093137033517e-262ThiF family
SGDYKL210W2.0006373583905387e-170UBA1 Ubiquitin activating enzy
me (E1), involved in ubiquitin
-mediated protein degradation
and essential for viability
DictyBaseDDB_G02702722.0004460046616782e-163uae1 on chromosome: 1 position
4544769 to 4548249
WormBaseWBGene000066991.0004025422005049e-134locus:uba-1 status:Confirmed
UniProt:Q3S1J5 protein_id
:CAJ30225.1
Stentor CoeruleusSteCoe_363531.4411565509640892e-64

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00481290(coding)
ATGTCTGAAGGTGATTACGATTACAATGAGGATATGGGTAATGAGGATGATTACTACTAT
GATGAAAACAATGACGATTATGGATACGATGAGGAACCATAACATAACGAGGAAGATTAT
AATCATTAAATGGAGGAGGAGACACCAGCTGTTTAAGGGTAGTTAGAATAAGCAGCAAAG
AATACAATTAAAAATAAGGTTTCAGTGAAAGAATAGCAAGATATAATAGATTTTTTAATT
TCTGATCACAAAGCCACAAAGCCTATTGCAGTCCTTTTACAATAAATTGAACCATTGTTA
TTGAACAAAGAGGAAATGCAACTCATATTTTTAAGAATAGGAAAGCTTTTAAATGAAATA
AAGAGATAAATTCAATTGTTACACAATGGAGGGTCTTGGAAATTTGATAAAAATGGCATT
GATAATTTAAATGAGCTTATTGAATTTACTTTCAGGTTTTTGTATATTTATTAATACAGT
TCTTTGGAGTAATTCATTGATAAGACCATCTTACTTAAGCTAGATTTTGATAAGCCCTTT
ACCAAAACTCTTTTAAATTTGCTTTTGAAGATAGACGACTATGCAGAAAGCATTTCGTTT
ACATTTACTGATAACATCAAGAAGGTATTTGTCTTTTGTTTGAACCCTAACGAACCTTTT
ACAAATCAAGATGATGGTATTTTGAATACAATTTCAGCTTAGCTCATTGATGTTATGGGT
ATGGAACCAACTCATCTGGTCTTTGACACTCTAATTTTAACTTATTTTTCTAATCCTTTA
AGAATGAGTGTTGTTTTAGCATAAAATATTATGCAAATAACTTCATAGTTAGAAAGCTAC
CTATAATCAGTAGACAAAGCTCTTAAGTTAAATGAACAATTGCTTGTTTTAAAAATGATT
TAGCTACTTATTTTTGCCAGTCAAAGTGATGCTAAAATACTTAACATACTGATCAGCGAA
GAGTTAGATAAAAGACTATATGATACAGTTAAATTCTCTGATGTTTCTTTTATTGGAGAT
GGTAAAAAGTAGTGGTCTGACGATGCAAGACTGATCTAAAGTATTGTTATTTTAATTAAG
ATTATTATATCAGGCAAAAAGAAAATTGATTAAAGATTCGCTTAGACTTTACTTGATGAC
TTCCTTTTCTTGATAAATCAGAACAAATTTAGTTTTATTTATTCAATCATTGTACCTATC
TTAACAACAAACGATACACAATACATTCCTTTCTGCTTACATAAAACTTGGGATATCAAT
TCTGTGTAAAATTTCAACTCATACTTGAAAGATATATCTAAAAAAGGAGTAAACGCAAAC
TAAATTCTTACAGATTGCAGAGTACCTACTGATTTGCTTGACGAAAGATAAAGAGAATAT
CTTTATAATTCTTTTATCAAAACTGGATAAAATAAAGATATAAAAGGTGTCTGGCGTAAA
ATTATGCAAATAGACAGAGATAACCCCACAATAAGCATAGATAAGACTCTCCCACTTCTA
GAAAACGAACCTTAAACTTTATTTATTTTCAACTGTACTTATTAGGGAACAAATATTAAG
TTTGGTGTCTATGTAAAGAATAAAATTGAAAGCTTCAAAAATCTTTAGCAGAATAGCGTA
TTCGACAAATCAAATAAAAATTTAAGGGCTACTTCAAATGCAGAAAGCTTCTTCTTTTAT
ATGGATGATTAAAGAATGTTCCATTTAAAATCAAATTAAAGGAAAAAATTAAAAACACAA
CAAGGAACAAAATGGATTACAAGCAACTAGGAACCATTTGCACCAAACATGAAAGATTTG
ATCAGAATAGAATATTCAGGTATTAGCTTCATTTTAGATGAGGATATTGCCATTTACATT
AATTTTGGTAATATTGATTTGAGCAAGTTCGATATTCCTTTCTAAGATATCGATTTAGAA
GATGCCTTTATTGCTAGTTCTAAGCTTAATATCGAAGAGATTTTCCTTGAAAACGCAGAA
ATCTGGCATTTAGAATAAGAAAATGCTAATGCAAAGATAGATTCTTACTTATAAATGTTC
TCTTAGAAGGAAGACTTGCAATCTATCTACATTCAATATTTAAAATATTTCCGTTTAGAG
AAAATTTCAATCGTTCCTCACTACATTACATTATAAGGTTTGATAACTAATTTTATCCAC
TAAGATAATAGCAATAAAAAAGTAGTAAAGAAAATAGCTAGCAAGTTGGATGATGAATTG
CAGCTTTCTTCCACAATTAAATAATTAGAATATATTTATGATGGCAGCAACACCAACAAA
ATACTTGATTTAATTGTTCCATATTCATAAGCAAACTTGTTAAAACTTCCCTTTGAAGAA
GAGTTTAGCAAGCTCTATGAAGTTAATAAGCTTGGTAAAAATTAAATGATTGAAATTTTC
TAGAATTAGTGCTAGGGAATAACAAAAATCATATAAATAATGGATAGAGAGGCACAATAG
CAATACTCTCAAAACCTTATGATCTTCTTCTTTGAAGCCCAAAAATTCTTGACCCTTCCT
CAATTTGCTAATCATTTAATTATTTAAAAGGATTTCTTTAAAATAATTTTACAATTGCTA
TTTACTCAGTAATTTGCTAACAACAAAGTTGGTATTGTAAACTTCCATTAGGCTGTTTAT
ATGCTCTTCAAATCACTAAGAAGATTATTTAAATATGACAAAAGTAGTGAATTGAGACAA
TTATGTTTTAGAAAGAACATTCTATAGGATATACTTTCTAAATTTGAAATATACAATGGA
CATTTGCCAACTAAAAAAAAGAATAAAAAGCCAAAAGTTGTTAATGAAGTATTTTAAGAA
TCTTCTTCTAAAAATAATGCAAGCTCTTCATTAACCTATGGTAGCGGTGGAAGCTCCAAT
CTTTCTAAGAAAGGTGTTGGATATGGAAACGGTAGCTCAGATACTTCTTGGATGAAAAAC
TATAGCAGCGGATATAGCACTGCTGTCTCTGAGGATGCATTAAATAATTAAAATAATTAC
AATAATTATTATGCTCCAGCACCCCCAAAATAAAATGTTTCTAACAATATTTTAGGCTTG
AAATAAAAATAAGATAATTTGATTTACAACGATACATCAACTATTAAAAGTTATGTTGGT
TCTGAATTTGTAGCTAAAATTTTGAAGCAGCTCTCTGCTTGTATTTAGCATTTCTTTGAG
TTTGATTATAGCTTTTAAATAACCACTGATATTTATCATAAAATTAAGTTATCAACACTT
AATCCAATACTCATAAATATTTTTGATACAAACAGTTTACTTGACTCAACAAAGCGTGCT
TCTTTCTTTAAACCAATCTTGATTTTGCTCTAAAATATTGCTAAAACCGATGAACTCTTA
GACTTCTTTGTATGGACAGAAGACCACTTAGAGAAACTATAAGGAGATTATGAAGAAAAT
GATAAAATAAAAGTTGAAGATGTGAAAAATTAAAAATGCCTATATTCACTTCTCTCCTCA
ATGAGAGATTAAGCAGAGTTTTTTGAAAAAAATATATTAAACTTGGATTAGAATGAATCT
TTATTCGATGCTCTTAAGTTGTCTCCTGCTTAAAGAGAAGCAAAGATAAAAGAGATCGAA
GAATAAAAATCCATGATTTAGCTGTACTTAAAAACATTTGAAATAATGGAAAAGGCTTTA
AAAGAAAATGATTATCTTTCAATAAAGGAAGTTGAAGACAACTAAAATTAAGAAACCTTA
AATCAACTAGAAGTTGGTAAGATGCACACTGAGTAGTTCTTCAATGTTTTGCTAAAACCT
CTCTGTGTAAGTACCTCTGTAGGAGTTACTTAAAAGCACCACTACTCAAGTTACTTTAAC
TCAGGAAATCCTTCTCCTATAAAAATGCAGAGACTCATAAAAGAAATAGCAGACTTAGCT
CATTCACTACCTATGACTCCCCAAAGTTCTATATTTGTTAGATATGACACTTCTAGAATG
GATGTAATGAAAAGTCTTATTTTTGGTGCTGAAGATACTCCTTACGCACATGGTGCATTT
GTCTTTGATATGTTTTTTGATGACTCTTATCCTTAAAACTCTCCCAAAGTAAACTTAGCA
ACAACAGGCTCTGCAAAAATTAGATTCAACCCTAATTTATATCACTGTGGTAAAGTCTGT
CTCAGTTTGTTAGGAACTTGGAGAGGTTCATCGAATGAAAATTGGAATCCAAATATCTCA
ACAATATTGTAGCTCTTAGTATCTATCTAAGCAATTGTCATGAGTGAATATGTCTACTTT
AATGAACCAGGCTATGAAGGGCATGCAGGTACTGCTGAAGGAGAAAAATTAAATAGAGGA
TATCAAAATATAGTTAAAATTGGTAATATCAGATATGCTATGATCGAATAAATAAATAAC
CCTCTTCCAGAGTTCAAAGAAGTTATAATGATGAGCTTCTTTTTGAAGAAGGATATGATA
TTGAAAGAGTGCGAGAAGTGGCTTGATTAAGCTGATCAACCAGCTGAATATACTGGATTA
GTTAGTTCTCATAATAGTACTTTCTGCTCTGAATTAAGTGGAGATAAATACAAAAAAGTT
TTACAAAAAGAAATCAATAATCTAAAGACATGCTTTGAAAAACTAAAAATCAATATTTCT
CAAACCATCAAATTCACCTAAAAAAAGAAAAAAATTGTAGAAATAGATTACGAAAAGCCT
TCAATATTATTTTAATCTGAAGAATCATTCAAGCCTAAAGTTTAAACACAAGATAAAATG
CTTGATGAAGGAAGAGTAGTCGATGTAAATAACGTCAATATTTCATACGACGATGTAAAG
AAAACTCAAAATAAAGAAATAAATGTTGAAAATTCAGAAGTTACTAATAGATGGTCTCGT
TATATAGGAGCTTTAGGAATAGATGCAGTCAAAAAGTAAGCAAATGCCAATGTCCTTTTG
GTCGGTTTAAACCATGTAGGTGTTGAAATAGCTAAAAACATAGTCTTAAGTGGTGTTAAA
AGATTCAGCATAGTTGACCAAGAAAAAGTCACTCTTTAAAATATAATAGGTTAATTTTTC
TTGAGCGAAGAAGACATCGGTAAAAATCGTGCTGAAGTTTCTATCAAAAAAATACAAGCT
CTAAATGAATATGTTTCATGCGATTTTTCAGCCAATTACAATGATTTATTAAATCAAACA
ACATTTTTCATTGAAAATTATAATGTTGTCATCCTTTGCAACTTAGATGTTAAAATGGCC
ACTAAAATCAATAAAATCTGTAGAGAAAAAAGTATAGGATTTATTTACACATAAAGCTAC
TCTGTATACAGTAGAATATTCTGTGATTTTGGTTCATCTTTCACTGTTATAGATAAAGAT
GGAGAACAAGCTTAGGAATATTTGATCAAAAATATTTCGAGAGATAATGAAGGACTTGTC
ACTCTTTAAACAGGTACCAAACATTATTTATAGGATGGCGATATCATTGAACTTAAAGAA
GTAATTAGCTAGAATGATGGAAAAAGCTTTAATTTACAATAATTCAAAGTTAAAATAAAA
GACAATAATTCATTTTATATTGGAGATACTAAATAGTTTGGAACTTACAGCAGAAATGGT
ATTGCAAAACACATTAAATAACCACTAACTTTGAAATTTAAGTCTCTTGAAGATAATATA
AGCAATCCTATTTTTGAAGAAAATCTGCTTCCTATTTTTACAGAAGAAGAAACAGCTTCT
AGAAATGCTTAGAATATTTGCTTCAATGTTTTGGATTAGTTTGTTTCTACTTATAGCAGA
CTTCCACGCCCTTGGAATACAGAAGATGCATCTAATTTTTATTAATTAGCTATTTAAAGC
TCATAGACAATCTAAAAGCTTATTGAAAGTAAATAAGAAAAAGCAATATAGTTAGCTTAG
ACTGCTATTCTCAGATTTGCATTTACATGCTAAGGATATATTCCTTCTTAAGGAGCTATC
ATTGGTGGTATTGTAGCTTAGGAAGCCGTTAAAAGTATTACTAAGAAATGGGTACCAATA
AATTAATTATTTATTTACAGCTGTGAAGAATTAGCAGCTGATGTAAGCATAGCCGAATAT
ATATAAAAATATGATTAAAAATCTATATAAATCGATTCTTACTTACAAAATATTTCTAAT
AAATATGGACTTAATTTCAAGAATGATAAATATGATAGCTTAAGAGTCATAATTGGAGAG
GAAATTTTAGAAAAAATCAGCAATGCTAATACATTTATGATAGGTGCTGGTGCTATAGGC
TGTGAGCTAATTAAAAATCTCTCCATGATAGGTTTCGGTAAAAAAGGCTCAATAACTTTG
ACAGATCCAGATATCATAGAAAATTCTAATCTCAATAGGCAATTCCTCTTCAGAGAAAAG
CACATTCGTCAACCAAAGTCTAGCGTTGCAGCTGCAGCAGCTATTTTCATGAATAAGGAC
TTGAAAAATAGTATCACTGCCAGACTAGACAAGGTTTATGAATAAACAGAGCATATATTC
AATGATACATTTTTCTAAAAATAAAATATCATACTGAATGCACTTGATAATGTCTAGGCA
CGTAAATACATGGATATAAGATGTATTTAAAATAGAAGGGCTTTAATAGATTCAGGTACC
TTAGGACCAAAGGGTCATGTTCAAGTTATCATTCCACATTTAACTGAAACTTATGGAAGC
TAATAAGACCCTTAAGAGGAAGGTGATATTCCTCACTGCACGTTAAAAATGTTCCCTGAG
TAAACCCTTCACTGTGTAGAGTGGGCTAGAGATAAATTCGGAAGAATGTACCAACAAAAG
CCTTAGAGTTTACAGAGAGTTTTAGAAGCCTTTAGAAATAACTAGCTGAATTCTTTAGAA
GAAAAGACTTTGAATGAAGGCTTAAAAATGTTGAAAAAATATCCTAAAAATTTTGATGAT
TGTTTGCAATATGGATTAAATAAATTCTATAAATTATACAATCATAATATACTTTCTTTA
TTGCACATATACCCACACAATCACAAGAATAAAGACGGTTCATTCTTCTGGACACTCCCA
AAACGTCCCCCAAATGCTCAGTAGTTCAATCCTTCAAATGATCACCATTTAAATTTCATA
TTATCATGTGCAGCCTTATAAGCTACAGTGTTTAACATTAAAATTAACTACAATTTAAAG
GATGCTAACACTCGTGCTAAATTATCCTAATAAATATAAAAAATGCAAATACCTTCATTC
AAGATAGATGAAAATAAATTGAAATCAATGAAGCAAGATGTTGATAAAGAAAAGAATAAA
TAGGAAAATAAAGTGGAAATGGAAATAGAAAAGCCTCAAAACAATCTTACTCCATAGCAG
CTTGTTAGTGAAATTAAGACAATTTGTTCTAAATTTAATGTCAATAAAATTCAAATATCG
CCATAGGAATTTGAAAAAGATGTTGATGATAACTATCACATAGATTTATTGCATTCAATG
GCTAATTGCCGTGCTATTAATTACACTTTAGAGCCAATGGAATGGATAGATGTAAAGCTC
AAGGCAGGAAAAATTATACCTGCTTTAGTAACAACAACATCGATTGTAGCAGGTCTTTAA
ATTATAGAAACAATAAAAATTTTGAAAGAAGTTAAAAGTGACTTTTATAAAAATGCTTTC
TTGAATCTAAGTTTGCCACTTCTTGTTTAGCCTGAGCCATAAAAAGCTGAGTAATTCAAA
CTTGCATAAAATTTAAATACAACTGTTTGGGACAGATGGGAAATTAAAATAAGTAAAGAA
AACGATAGTTTAGAAAAGCTATTTAGCTACTTGTAAAAAACCTACAAGATATATCCCCAT
GATGTATTCTAAGGAAATAAACCTATTTACATAGAATAATTGATGTTACTTCCTAACCGC
GATTAAGAAAGAAAAGACTTACTATCCACAAAACTGAATAAAATATTAGAACTTAAATCA
AAAGAAGATAATTTCGTTGACATTAATGTTACTTTCACCCAAACTCCAGAATATACAAAC
TAATTAAAAGGAGTTCCATTAATTAGATTATTCTTTTGA


>TTHERM_00481290(protein)
MSEGDYDYNEDMGNEDDYYYDENNDDYGYDEEPQHNEEDYNHQMEEETPAVQGQLEQAAK
NTIKNKVSVKEQQDIIDFLISDHKATKPIAVLLQQIEPLLLNKEEMQLIFLRIGKLLNEI
KRQIQLLHNGGSWKFDKNGIDNLNELIEFTFRFLYIYQYSSLEQFIDKTILLKLDFDKPF
TKTLLNLLLKIDDYAESISFTFTDNIKKVFVFCLNPNEPFTNQDDGILNTISAQLIDVMG
MEPTHLVFDTLILTYFSNPLRMSVVLAQNIMQITSQLESYLQSVDKALKLNEQLLVLKMI
QLLIFASQSDAKILNILISEELDKRLYDTVKFSDVSFIGDGKKQWSDDARLIQSIVILIK
IIISGKKKIDQRFAQTLLDDFLFLINQNKFSFIYSIIVPILTTNDTQYIPFCLHKTWDIN
SVQNFNSYLKDISKKGVNANQILTDCRVPTDLLDERQREYLYNSFIKTGQNKDIKGVWRK
IMQIDRDNPTISIDKTLPLLENEPQTLFIFNCTYQGTNIKFGVYVKNKIESFKNLQQNSV
FDKSNKNLRATSNAESFFFYMDDQRMFHLKSNQRKKLKTQQGTKWITSNQEPFAPNMKDL
IRIEYSGISFILDEDIAIYINFGNIDLSKFDIPFQDIDLEDAFIASSKLNIEEIFLENAE
IWHLEQENANAKIDSYLQMFSQKEDLQSIYIQYLKYFRLEKISIVPHYITLQGLITNFIH
QDNSNKKVVKKIASKLDDELQLSSTIKQLEYIYDGSNTNKILDLIVPYSQANLLKLPFEE
EFSKLYEVNKLGKNQMIEIFQNQCQGITKIIQIMDREAQQQYSQNLMIFFFEAQKFLTLP
QFANHLIIQKDFFKIILQLLFTQQFANNKVGIVNFHQAVYMLFKSLRRLFKYDKSSELRQ
LCFRKNILQDILSKFEIYNGHLPTKKKNKKPKVVNEVFQESSSKNNASSSLTYGSGGSSN
LSKKGVGYGNGSSDTSWMKNYSSGYSTAVSEDALNNQNNYNNYYAPAPPKQNVSNNILGL
KQKQDNLIYNDTSTIKSYVGSEFVAKILKQLSACIQHFFEFDYSFQITTDIYHKIKLSTL
NPILINIFDTNSLLDSTKRASFFKPILILLQNIAKTDELLDFFVWTEDHLEKLQGDYEEN
DKIKVEDVKNQKCLYSLLSSMRDQAEFFEKNILNLDQNESLFDALKLSPAQREAKIKEIE
EQKSMIQLYLKTFEIMEKALKENDYLSIKEVEDNQNQETLNQLEVGKMHTEQFFNVLLKP
LCVSTSVGVTQKHHYSSYFNSGNPSPIKMQRLIKEIADLAHSLPMTPQSSIFVRYDTSRM
DVMKSLIFGAEDTPYAHGAFVFDMFFDDSYPQNSPKVNLATTGSAKIRFNPNLYHCGKVC
LSLLGTWRGSSNENWNPNISTILQLLVSIQAIVMSEYVYFNEPGYEGHAGTAEGEKLNRG
YQNIVKIGNIRYAMIEQINNPLPEFKEVIMMSFFLKKDMILKECEKWLDQADQPAEYTGL
VSSHNSTFCSELSGDKYKKVLQKEINNLKTCFEKLKINISQTIKFTQKKKKIVEIDYEKP
SILFQSEESFKPKVQTQDKMLDEGRVVDVNNVNISYDDVKKTQNKEINVENSEVTNRWSR
YIGALGIDAVKKQANANVLLVGLNHVGVEIAKNIVLSGVKRFSIVDQEKVTLQNIIGQFF
LSEEDIGKNRAEVSIKKIQALNEYVSCDFSANYNDLLNQTTFFIENYNVVILCNLDVKMA
TKINKICREKSIGFIYTQSYSVYSRIFCDFGSSFTVIDKDGEQAQEYLIKNISRDNEGLV
TLQTGTKHYLQDGDIIELKEVISQNDGKSFNLQQFKVKIKDNNSFYIGDTKQFGTYSRNG
IAKHIKQPLTLKFKSLEDNISNPIFEENLLPIFTEEETASRNAQNICFNVLDQFVSTYSR
LPRPWNTEDASNFYQLAIQSSQTIQKLIESKQEKAIQLAQTAILRFAFTCQGYIPSQGAI
IGGIVAQEAVKSITKKWVPINQLFIYSCEELAADVSIAEYIQKYDQKSIQIDSYLQNISN
KYGLNFKNDKYDSLRVIIGEEILEKISNANTFMIGAGAIGCELIKNLSMIGFGKKGSITL
TDPDIIENSNLNRQFLFREKHIRQPKSSVAAAAAIFMNKDLKNSITARLDKVYEQTEHIF
NDTFFQKQNIILNALDNVQARKYMDIRCIQNRRALIDSGTLGPKGHVQVIIPHLTETYGS
QQDPQEEGDIPHCTLKMFPEQTLHCVEWARDKFGRMYQQKPQSLQRVLEAFRNNQLNSLE
EKTLNEGLKMLKKYPKNFDDCLQYGLNKFYKLYNHNILSLLHIYPHNHKNKDGSFFWTLP
KRPPNAQQFNPSNDHHLNFILSCAALQATVFNIKINYNLKDANTRAKLSQQIQKMQIPSF
KIDENKLKSMKQDVDKEKNKQENKVEMEIEKPQNNLTPQQLVSEIKTICSKFNVNKIQIS
PQEFEKDVDDNYHIDLLHSMANCRAINYTLEPMEWIDVKLKAGKIIPALVTTTSIVAGLQ
IIETIKILKEVKSDFYKNAFLNLSLPLLVQPEPQKAEQFKLAQNLNTTVWDRWEIKISKE
NDSLEKLFSYLQKTYKIYPHDVFQGNKPIYIEQLMLLPNRDQERKDLLSTKLNKILELKS
KEDNFVDINVTFTQTPEYTNQLKGVPLIRLFF


>TTHERM_00481290(gene)
ATGTCTGAAGGTGATTACGATTACAATGAGGATATGGGTAATGAGGATGATTACTACTAT
GATGAAAACAATGACGATTATGGATACGATGAGGAACCATAACATAACGAGGAAGATTAT
AATCATTAAATGGAGGAGGAGACACCAGCTGTTTAAGGTTTGGAACTAATAATTACTTTT
TTTTTCATTTCTATAAGCTTAAATTAACAAAAAAGATAAAGCTCATTAGGATTACAGTAT
CTAAAATTTTCTTCAAATTATTAGGGTAGTTAGAATAAGCAGCAAAGAATACAATTAAAA
ATAAGGTTTCAGTGAAAGAATAGCAAGATATAATAGATTTTTTAATTTCTGATCACAAAG
CCACAAAGCCTATTGCAGTCCTTTTACAATAAATTGAACCATTGTTATTGAACAAAGAGG
AAATGCAACTCATATTTTTAAGAATAGGAAAGCTTTTAAATGAAATAAAGAGATAAATTC
AATTGTTACACAATGGAGGGTCTTGGAAATTTGATAAAAATGGCATTGATAATTTAAATG
AGCTTATTGAATTTACTTTCAGGTTTTTGTATATTTATTAATACAGTTCTTTGGAGTAAT
TCATTGATAAGACCATCTTACTTAAGCTAGATTTTGATAAGCCCTTTACCAAAACTCTTT
TAAATTTGCTTTTGAAGATAGACGACTATGCAGAAAGCATTTCGTTTACATTTACTGATA
ACATCAAGAAGGTATTTGTCTTTTGTTTGAACCCTAACGAACCTTTTACAAATCAAGATG
ATGGTATTTTGAATACAATTTCAGCTTAGCTCATTGATGTTATGGGTATGGAACCAACTC
ATCTGGTCTTTGACACTCTAATTTTAACTTATTTTTCTAATCCTTTAAGAATGAGTGTTG
TTTTAGCATAAAATATTATGCAAATAACTTCATAGTTAGAAAGCTACCTATAATCAGTAG
ACAAAGCTCTTAAGTTAAATGAACAATTGCTTGTTTTAAAAATGATTTAGCTACTTATTT
TTGCCAGTCAAAGTGATGCTAAAATACTTAACATACTGATCAGCGAAGAGTTAGATAAAA
GACTATATGATACAGTTAAATTCTCTGATGTTTCTTTTATTGGAGATGGTAAAAAGTAGT
GGTCTGACGATGCAAGACTGATCTAAAGTATTGTTATTTTAATTAAGATTATTATATCAG
GCAAAAAGAAAATTGATTAAAGATTCGCTTAGACTTTACTTGATGACTTCCTTTTCTTGA
TAAATCAGAACAAATTTAGTTTTATTTATTCAATCATTGTACCTATCTTAACAACAAACG
ATACACAATACATTCCTTTCTGCTTACATAAAACTTGGGATATCAATTCTGTGTAAAATT
TCAACTCATACTTGAAAGATATATCTAAAAAAGGAGTAAACGCAAACTAAATTCTTACAG
ATTGCAGAGTACCTACTGATTTGCTTGACGAAAGATAAAGAGAATATCTTTATAATTCTT
TTATCAAAACTGGATAAAATAAAGATATAAAAGGTGTCTGGCGTAAAATTATGCAAATAG
ACAGAGATAACCCCACAATAAGCATAGATAAGACTCTCCCACTTCTAGAAAACGAACCTT
AAACTTTATTTATTTTCAACTGTACTTATTAGGGAACAAATATTAAGTTTGGTGTCTATG
TAAAGAATAAAATTGAAAGCTTCAAAAATGTAAATTTTAAATATAAAATTTTTATTTAAA
AATCATTTCTTTATTTTAAAGCTAGCAATTTTTATTAAGAAAAATTTTTTTTAATAATAA
GCTTTAGCAGAATAGCGTATTCGACAAATCAAATAAAAATTTAAGGGCTACTTCAAATGC
AGAAAGCTTCTTCTTTTATATGGATGATTAAAGAATGTTCCATTTAAAATCAAATTAAAG
GAAAAAATTAAAAACACAACAAGGAACAAAATGGATTACAAGCAACTAGGAACCATTTGC
ACCAAACATGAAAGATTTGATCAGAATAGAATATTCAGGTATTAGCTTCATTTTAGATGA
GGATATTGCCATTTACATTAATTTTGGTAATATTGATTTGAGCAAGTTCGATATTCCTTT
CTAAGATATCGATTTAGAAGATGCCTTTATTGCTAGTTCTAAGCTTAATATCGAAGAGAT
TTTCCTTGAAAACGCAGAAATCTGGCATTTAGAATAAGAAAATGCTAATGCAAAGATAGA
TTCTTACTTATAAATGTTCTCTTAGAAGGAAGACTTGCAATCTATCTACATTCAATATTT
AAAATATTTCCGTTTAGAGAAAATTTCAATCGTTCCTCACTACATTACATTATAAGGTTT
GATAACTAATTTTATCCACTAAGATAATAGCAATAAAGTAAATTTTAGAATTTTTTGTAA
AAATTTTTGTTTTAATAATATTTTATAATTAAATTATAGAAAGTAGTAAAGAAAATAGCT
AGCAAGTTGGATGATGAATTGCAGCTTTCTTCCACAATTAAATAATTAGAATATATTTAT
GATGGCAGCAACACCAACAAAATACTTGATTTAATTGTTCCATATTCAGTAAATAATTTA
TTTTATAAATTAAAAAAAATTAATCTATTTTAATAAACAGTAAGCAAACTTGTTAAAACT
TCCCTTTGAAGAAGAGTTTAGCAAGCTCTATGAAGTTAATAAGCTTGGTAAAAATTAAAT
GATTGAAATTTTCTAGAATTAGTGCTAGGGAATAACAAAAATCATATAAATAATGGATAG
AGAGGCACAATAGCAATACTCTCAAAACCTTATGATCTTCTTCTTTGAAGCCCAAAAATT
CTTGACCCTTCCTCAATTTGCTAATCATTTAATTATTTAAAAGGATTTCTTTAAAATAAT
TTTACAATTGCTATTTACTCAGTAATTTGCTAACAACAAAGTTGGTATTGTAAACTTCCA
TTAGGCTGTTTATATGCTCTTCAAATCACTAAGAAGATTATTTAAATATGACAAAGTAAG
TTTTATTTTTATCAAATTATTTTTTAAGGTTTTTTATTCATTTATATTAGAGTAGTGAAT
TGAGACAATTATGTTTTAGAAAGAACATTCTATAGGATATACTTTCTAAATTTGAAATAT
ACAATGGACATTTGCCAACTAAAAAAAAGAATAAAAAGCCAAAAGTTGTTAATGAAGTAT
TTTAAGAATCTTCTTCTAAAAATAATGCAAGCTCTTCATTAACCTATGGTAGCGGTGGAA
GCTCCAATCTTTCTAAGAAAGGTGTTGGATATGGAAACGGTAGCTCAGATACTTCTTGGA
TGAAAAACTATAGCAGCGGATATAGCACTGCTGTCTCTGAGGATGCATTAAATAATTAAA
ATAATTACAATAATTATTATGCTCCAGCACCCCCAAAATAAAATGTTTCTAACAATATTT
TAGGCTTGAAATAAAAATAAGATAATTTGATTTACAACGATACATCAACTATTAAAAGTT
ATGTTGGTTCTGAATTTGTAGCTAAAATTTTGAAGCAGCTCTCTGCTTGTATTTAGCATT
TCTTTGAGTTTGATTATAGCTTTTAAATAACCACTGATATTTATCATAAAATTAAGTTAT
CAACACTTAATCCAATACTCATAAATATTTTTGATACAAACAGTTTACTTGACTCAACAA
AGCGTGCTTCTTTCTTTAAACCAATCTTGATTTTGCTCTAAAATATTGCTAAAACCGATG
AACTCTTAGACTTCTTTGTATGGACAGAAGACCACTTAGAGAAACTATAAGGAGATTATG
AAGAAAATGATAAAATAAAAGTTGAAGATGTGAAAAATTAAAAATGCCTATATTCACTTC
TCTCCTCAATGAGAGATTAAGCAGAGTTTTTTGAAAAAAATATATTAAACTTGGATTAGA
ATGAATCTTTATTCGATGCTCTTAAGTTGTCTCCTGCTTAAAGAGAAGCAAAGATAAAAG
AGATCGAAGAATAAAAATCCATGATTTAGCTGTACTTAAAAACATTTGAAATAATGGAAA
AGGCTTTAAAAGAAAATGATTATCTTTCAATAAAGGAAGTTGAAGACAACTAAAATTAAG
AAACCTTAAATCAACTAGAAGTTGGTAAGATGCACACTGAGTAGTTCTTCAATGTTTTGC
TAAAACCTCTCTGTGTAAGTACCTCTGTAGGAGTTACTTAAAAGCACCACTACTCAAGTT
ACTTTAACTCAGGAAATCCTTCTCCTATAAAAATGCAGAGACTCATAAAAGAAATAGCAG
ACTTAGCTCATTCACTACCTATGACTCCCCAAAGTTCTATATTTGTTAGATATGACACTT
CTAGAATGGATGTAATGAAAAGTCTTATTTTTGGTGCTGAAGATACTCCTTACGCACATG
GTGCATTTGTCTTTGATATGTTTTTTGATGACTCTTATCCTTAAAACTCTCCCAAAGTAA
ACTTAGCAACAACAGGTAATTATAAACTTTATAAGATATTTCAAATTTCTAATTTTTCAT
TACAAAAATAGGCTCTGCAAAAATTAGATTCAACCCTAATTTATATCACTGTGGTAAAGT
CTGTCTCAGTTTGTTAGGAACTTGGAGAGGTTCATCGAATGAAAATTGGAATCCAAATAT
CTCAACGTAATTCATTCAAATTTTCTTTAAAAAAACATTTTAATTATCAAGCAAAACTTT
TAAAAATGGAAATTTTTTAATTTATCATTTATTTTGATAGAAAAAATGTTGCTTTAAAAA
ATAGAATAACTTATAAAAAATTGGTTATTTAATTTAACATTTGTCTTATAAAATAGAATA
TTGTAGCTCTTAGTATCTATCTAAGCAATTGTCATGAGTGAATATGTCTACTTTAATGAA
CCAGGCTATGAAGGGCATGCAGGTACTGCTGAAGGAGAAAAATTAAATAGAGGATATCAA
AATATAGTTAAAATTGGTAATATCAGATATGCTATGATCGAATAAATAAATAACCCTCTT
CCAGAGTTCAAAGAAGTTATAATGATGAGCTTCTTTTTGAAGAAGGATATGATATTGAAA
GAGTGCGAGAAGTGGCTTGATTAAGCTGATCAACCAGCTGAATATACTGGATTAGTTAGT
TCTCATAATAGTACTTTCTGCTCTGAATTAAGTGGAGATAAATACAAAAAAGTTTTACAA
AAAGAAATCAATAATCTAAAGACATGCTTTGAAAAACTAAAAATCAATATTTCTCAAACC
ATCAAATTCACCTAAAAAAAGAAAAAAATTGTAGAAATAGATTACGAAAAGCCTTCAATA
TTATTTTAATCTGAAGAATCATTCAAGCCTAAAGTTTAAACACAAGATAAAATGCTTGAT
GAAGGAAGAGTAGTCGATGTAAATAACGTCAATATTTCATACGACGATGTAAACATATTT
TTTAACATTGAAAATTTATATATCTAATTAAATTTTAAATTTCAGGTAAAGAAAACTCAA
AATAAAGAAATAAATGTTGAAAATTCAGAAGTTACTAATAGATGGTCTCGTTATATAGGA
GCTTTAGGAATAGATGCAGTCAAAAAGTAAGCAAATGCCAATGTCCTTTTGGTCGGTTTA
AACCATGTAGGTGTTGAAATAGCTAAAAACATAGTCTTAAGTGGTGTTAAAAGATTCAGC
ATAGTTGACCAAGAAAAAGTCACTCTTTAAAATATAATAGGTTAATTTTTCTTGAGCGAA
GAAGACATCGGTAAAAATCGTGCTGAAGTTTCTATCAAAAAAATACAAGCTCTAAATGAA
TATGTTTCATGCGATTTTTCAGCCAATTACAATGATTTATTAAATCAAACAACATTTTTC
ATTGAAAATTATAATGTTGTCATCCTTTGCAACTTAGATGTTAAAATGGCCACTAAAATC
AATAAAATCTGTAGAGAAAAAAGTATAGGATTTATTTACACATAAAGCTACTCTGTATAC
AGTAGAATATTCTGTGATTTTGGTTCATCTTTCACTGTTATAGATAAAGATGGGTAATTT
TTATTCTTTTTATTTTTATTTTCAACCAATAAATTATTGAAAAAAAACCGAATAAAATAC
TGCAAAAATATATTTACTGTCGAACCCTAATTTTTTATCTTTAAAATTGTTTTAGAATAT
GATTAGGTTTTTTAGTTAATTTGTTTTATTTTTTAAATTGAAATAGAGAACAAGCTTAGG
AATATTTGATCAAAAATATTTCGAGAGATAATGAAGGACTTGTCACTCTTTAAACAGGTA
CCAAACATTATTTATAGGATGGCGATATCATTGAACTTAAAGAAGTAATTAGCTAGAATG
ATGGAAAAAGCTTTAATTTACAATAATTCAAAGTTAAAATAAAAGACAATGTAAATTTTT
TATTCCTTATTACCTCATATTTAATTTTAAATAAATAAATAGAATTCATTTTATATTGGA
GATACTAAATAGTTTGGAACTTACAGCAGAAATGGTATTGCAAAACACATTAAATAACCA
CTAACTTTGAAATTTAAGTCTCTTGAAGATAATATAAGCAATCCTATTTTTGAAGAAAAT
CTGCTTCCTATTTTTACAGAAGAAGAAACAGCTTCTAGAAATGCTTAGAATATTTGCTTC
AATGTTTTGGATTAGTTTGTTTCTACTTATAGCAGACTTCCACGCCCTTGGAATACAGAA
GATGCATCTAATTTTTATTAATTAGCTATTTAAAGCTCATAGACAATCTAAAAGCTTATT
GAAAGTAAATAAGAAAAAGCAATATAGTTAGCTTAGACTGCTATTCTCAGATTTGCATTT
ACATGCTAAGGATATATTCCTTCTTAAGGAGCTATCATTGGTGGTATTGTAGCTTAGGAA
GCCGTTAAAAGTATTACTAAGAAATGGGTACCAATAAATTAATTATTTATTTACAGCTGT
GAAGAATTAGCAGCTGATGTAAGCATAGCCGAATATATATAAAAATATGATTAAAAATCT
ATATAAATCGATTCTTACTTACAAAATATTTCTAATAAATATGGACTTAATTTCAAGAAT
GATAAATATGATAGCTTAAGAGTCATAATTGGAGAGGAAATTTTAGAAAAAATCAGCAAT
GCTAATACATTTATGATAGGTGCTGGTGCTATAGGCTGTGAGCTAATTAAAAATCTCTCC
ATGATAGGTTTCGGTAAAAAAGGCTCAATAACTTTGACAGATCCAGATATCATAGAAAAT
TCTAATCTCAATAGGCAATTCCTCTTCAGAGAAAAGCACATTCGTCAACCAAAGTCTAGG
TAAGTTTTTATTCATTTAAAATTTATATAAAACAAACAGCTCAACAAAGATAACAAAATT
TGTTTAATTTATAAATAAGCGTTGCAGCTGCAGCAGCTATTTTCATGAATAAGGACTTGA
AAAATAGTATCACTGCCAGACTAGACAAGGTTTATGAATAAACAGAGCATATATTCAATG
ATACATTTTTCTAAAAATAAAATATCATACTGAATGCACTTGATAATGTCTAGGCACGTA
AATACATGGATATAAGATGTATTTAAAATAGAAGGGCTTTAATAGATTCAGGTACCTTAG
GACCAAAGGGTCATGTTCAAGTAAATGATTTAAACCTTTATTTAATTTCTATATATTTAT
ATATAAAATTAACATTTATAAAAAGGTTATCATTCCACATTTAACTGAAACTTATGGAAG
CTAATAAGACCCTTAAGAGGAAGGTGATATTCCTCACTGCACGTTAAAAATGTTCCCTGA
GTAAACCCTTCACTGTGTAGAGTGGGCTAGAGATAAATTCGGAAGAATGTACCAACAAAA
GCCTTAGAGTTTACAGAGAGTTTTAGAAGCCTTTAGAAATAACTAGCTGAATTCTTTAGA
AGAAAAGACTTTGAATGAAGGCTTAAAAATGTTGAAAAAATATCCTAAAAATTTTGATGA
TTGTTTGCAATATGGATTAAATAAATTCTATAAATTATACAATCATAATATACTTTCTTT
ATTGCACATATACCCACACAATCACAAGAATAAAGACGGTTCATTCTTCTGGACACTCCC
AAAACGTCCCCCAAATGCTCAGTAGTTCAATCCTTCAAATGATCACCATTTAAATTTCAT
ATTATCATGTGCAGCCTTATAAGCTACAGTGTTTAACATTAAAATTAACTACAATTTAAA
GGATGCTAACACTCGTGCTAAATTATCCTAATAAATATAAAAAATGCAAATACCTTCATT
CAAGATAGATGAAAATAAATTGAAATCAATGAAGCAAGATGTTGATAAAGAAAAGAATAA
ATAGGAAAATAAAGTGGAAATGGAAATAGAAAAGCCTCAAAACAATCTTACTCCATAGCA
GCTTGTTAGTGAAATTAAGACAATTTGTTCTAAATTTAATGTCAATAAAATTCAAATATC
GCCATAGGAATTTGAAAAAGATGTTGATGATAACTATCACATAGATTTATTGCATTCAAT
GGCTAATTGCCGTGCTATTAATTACACTTTAGAGCCAATGGAATGGATAGATGTAAAGCT
CAAGGCAGGAAAAATTATACCTGCTTTAGTAACAACAACATCGATTGTAGCAGGTCTTTA
AATTATAGAAACAATAAAAATTTTGAAAGAAGTTAAAAGTGACTTTTATAAAAATGCTTT
CTTGAATCTAAGTTTGCCACTTCTTGTTTAGCCTGAGCCATAAAAAGCTGAGTAATTCAA
ACTTGCATAAAATTTAAATACAACTGTTTGGGACAGATGGGAAATTAAAATAAGTAAAGA
AAACGATAGTTTAGAAAAGCTATTTAGCTACTTGTAAAAAACCTACAAGATATATCCCCA
TGATGTATTCTAAGGAAATAAACCTATTTACATAGAATAATTGATGTTACTTCCTAACCG
CGATTAAGAAAGAAAAGACTTACTATCCACAAAACTGAATAAAATATTAGAACTTAAAGT
AAATTATTTTTTTTAAATATTAAAAATATTTTAATTTAATTTTTTTTTAAGTCAAAAGAA
GATAATTTCGTTGACATTAATGTTACTTTCACCCAAACTCCAGAATATACAAACTAATTA
AAAGGAGTTCCATTAATTAGATTATTCTTTTGA