Identifiers and Description

Gene Model Identifier

TTHERM_00028560

Standard Name

UBA12 (Ubiquitin-Activating enzyme; UBA1 ortholog)

Aliases

PreTt14186 | 2.m02165 | 3825.m02579

Description

ubiquitin-activating enzyme E1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00028560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00758.19.997093137033517e-262ubiquitin-activating enzyme E1
family protein (7347 aa)
OxytrichaContig290.0.g679.997093137033517e-262ThiF family
DictyBaseDDB_G02702721.999807452113044e-171uae1 on chromosome: 1 position
4544769 to 4548249
SGDYKL210W9.997105718980434e-168UBA1 Ubiquitin activating enzy
me (E1), involved in ubiquitin
-mediated protein degradation
and essential for viability
WormBaseWBGene000066991.999872053281847e-142locus:uba-1 status:Confirmed
UniProt:Q3S1J5 protein_id
:CAJ30225.1
Stentor CoeruleusSteCoe_181725.301718666092324e-65

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00028560(coding)
ATGAAAACAAGTTATAGTGAAAAGGTTATTGCTGATATATCAAAATGCTCTGATTTCACA
TATGATAGCAAAAATCAAGAATTAATATTTATAGATTCTTGTCTTTCATTAAAATCTATA
AGAGTTATTGAGAATAGTGAGTCATAAATAATAAATTGGAAAGATGTAAATATTTAAATT
TTGCATAATGGTTAATAAGATTTATCTCCTCAGCTTTAAAGTTCTTAAAACGTTAATTTT
TTATCATCTTAGAAAGCAACTTAATTTGATAATAATGAAAAATAATAACAATCTATAACA
AGCTAACCTGCACTAATTGAAAACCAAGGCATAGAATTAGACATTTAAGAATAAGCTAAT
TAATTAAATTATTCATCTGCACGCATGATACCATATATTAGCTAATAGACAGCAAACCTT
CCTGCTAACTAATAAAATAAATTACTTTTTTCTAATTCAGGTCTTACAGTAACATGCATG
GATACATCACCTTAAATAGCAATTTCAACAATAGGATTTTGTGAAGGAGAACATTTTTGG
GAGTTTTATTGTCCTATTTACTGTTAAAAAATAGAAATGGGTATAATTGCTCCTTCCATA
TAATAGTTTCATTTAATCGAGTTCCATACAACAACTCCAAGACAAGTTACTTTTAGATTG
AATTTCAATACATGCAAGCTTTCTACTTACTTAAATGGCAATTTAAACAATCAAAAATCT
TAAATTCTCTCCTTCTTAAAACCCTTAAGCGACTAAAATGCAGTATCATCTGAATCAAAT
TCCTAATAGATTATGTGGTTTCCTGCTATTAAGATGAAAGAGGTAGGAGTGAGTGTTATA
TTTAATCCCTTCGCATATGATCCAGAAAATCCTATGTCTGCATATAATTTCAGGCAACAG
TAGAACTAACAATTATAGGAAAATAAAGTTAATTTAGATGAAAGCATGATAACAGAGGTT
TTGTAGAGAATATAATAGCTTAATCTTACAATTAGAGAAAAGCGTGATACATAAAATAGC
GAATAGACTAAAGATTTCAATGCAGATAGCGAAAACCAAGCATCTGATAAAAGTAAAGAA
AAATAGATACCATATAACCAAATTAGCGCTAACATGAAAAATAATAATCTAGTTATTATT
TAAAATGACAAAATCAAACTCATTAAAAAGGATGAGTCTGGATAATACCCTGTTACTAAA
TCTATATTTTATAATAAACCAAAAACTCCTGCAGATTACATTTATTTAACCTTAAATATT
AACGACACTATCTTCTTGCTAGAAAGAGTAGATTGGGCTAGTTTAATAGAAGATAATTAT
TTAGGCTTGAAAGAAGTTCATTCATTAATTGAGCTGATTAAAATATCTGTTTCATAAGCT
AATTTTTAAAATAAGTACATTTAAATACACTTGTAATTTTCATTAGCCAAGAAATGTGTA
GATGCTTTAGGATTATTCTCTCTTCAATAATATAAAATTATTCATGAACTGCTCCATACT
GAAAAGTTAGATCAAATTCTATTTAATTTCCCACTATAATCATCTTTGTATGGATCCTCT
TAATTTAATTCTGATAACTAGAGTAAATCTTGTGTATTTAAGGTGTCACAAACTTATGAT
AGCGTTATTGAATAAATTAGAATAATGCTGAGTCTTGATGAATAATTGTTTGCTATGACT
CTTCATCAGGAGGCTAACTCCAAGCTTGCTCATATGTTTGCTAATAGCCTTTCAAGAATA
TATAGCAGTTTTTGTAGACTTGGCTCTTTAATGAATTACACAAAATCTTAATATTCACCA
CTTGAATTGTCAGAAGCAGGATTGTATAACACATATGATACTTTATCAAGTTTAAGACAC
TTTGAATTTCCTTTTATTAAAATTGATTAGTTAGAAACATATAAAAAGAAAGTACCTCTC
TGGCAAAATATTTCATTATAAATTCCTCATAGCAGAATGATGAAAGGACAAACATGCTTA
AATGTTCCACTCTATATCACAATTAATAATATTCCTTTTCAATAGCATATAAGAGCTAGA
TAATTGAATAAAGATAATAAGGATTAATGTGATTTTAATTAAATCAGAATACTAAGACCT
AATAGATAATATACATCAAATTATATTTCCACTGTAAGTTCTGATGGATGTGTCAATGTT
TGGAATACTGAAATATCTTTACTAAGGGTATTTGTTAGTGATTTTAAGAGAGATTTTGTT
CCACCCAAATCTCTAAAAGGACTGCTTAGCACCAACGATCTCAAGGCAAATCTAAAAAAT
GTGGAAAGCGGACTTTTTTATGATTTAAAATTCCCTACTAAACCTCAAAATAAGCCAAGA
GAGTCTAAATAGATCGATTAGAAAAAAGATTTTAAGAATTAAATAAAGGATATATTTTGT
AAGCAAGTAGGTAAAAACCTTTTAGCATAATAGGGATACGACTAAGAAATAGCTTCTAAA
GTTATCAAAAATATTAAAAACAATGTGCTTGAAGATGCTGTTAAAGAAACAGAGAAAATA
AAAACATAAAATAATTAATAAGAAGAAGAATTTTTAGAGTCTGTTCAAAACTCATAAAAT
GCTCCAGAAGAAGAAGATGATTAAGCATCTTAAGAAAATGAATTGGAATGGATTTGTTTG
CAATGCACTTTTAGAAATACTCTCCCTGAGTTCTAAAATGAATGCGAAAATTGTTAGAAA
CCCAGAAGAACACAAACAAATTTAGAATTGCTAAAAGAAATAAATATTAAAAAGTAAAAA
TCGAAAGAGCTTTCTGCAATTGAAGCCATGAATAAGCTAGACTAGTTGATAAATTATAAT
GCGAAAGTTGCTAATGAAAAGCAAAAATTAGAGGAAAGTTAAATGATAAATCCTATGCAG
CAGATGACTGTATCAATTACTTCAATAACATAAGAAAATAAATAGCCTTTAAATGAGGAG
AAATCATATATCAGACCAGAGTGGGTTTGTCCTCAGTGTGATTAAATCGTGCAAAGATCG
TAAGAAATATGTGACAAATGTGGCACACATGTACCAGAAGAATTTAAATGCACCTATCAA
GAATATAAATCCCTCAAATAAGGAATTGAAAAAAAAATGAAGGAAGAAATGGAAAAGAAG
TAGGCTAAGAGAGAAGAAGATTTAAAAAACTTTTGTTTAGATGAAAATAGCAAAGTTTAA
ACAGGAATTATGATAAACTGTGAGCTAAGTAAAGTTTGCCCATTAATAGTAGGTGTGGGT
ATGAATAGCACTAAAAAAGATAGTGAGGTGCAGTCGATGTTGAGGATCAGAAGATTTGGA
TTCGATCCAAATTATTTAAATAACTTTTACAAGCTAAGTAATCTTACAGGCTAACCTAAC
ACAAATTAGAATGGAAGTAATATATAATCTTCTAAAACAGTTATAAATTAACTAGATGGA
TCTGTTATTACAGAAAAAACAATGGGTAGTATAGAAGATTCACTATTTAGAAGTGAAAAT
AATAGGTAGGTAGTAGAGTCGATAGAACCACTTTTCATGAGCAATAACAGATTTTCAAAT
GACTCATCCACTCACCAGTAATCAATAGAGCAATAACAGAAAATAGTAAACCAAAAGAAT
GCTCTTTTCCATTAAGATTGGCTGGAATTAGCATAGCATGATATAGTTCTGAATGAAGAA
AGAATCATAGATTGTGTTTCCTGGTGCATAGATTCAGATATTTAAATGGCTCATGATAGC
ATAATTAAGAATAAGGAAATGACCACCTCAAATTATAATTATTAAATGAATCACACTGGA
GAACAACATCAAGAAACTCCAGAAAATCCTGATAAATTACCTTACATTTCTTCATCATAT
TCACAAACATCGTCACCTCAAATGATGGCTAGCTTAGAAGGCAGATAAAGCTTTGATAGA
TCATAATAAAATTTCTTATTAGATTAAGAAAGCACTAATATCAACAGCCTTAGAAAAGAA
TGGTTTAGAATAGTGCTTCTGACAGAAACTATGAACTAATCTATTAAAGTACATATTTAT
CGACTTGAAGTAGATAATATTAACCCTTACAGCAGCGATTCGATATAAATATCCATTCTA
AAAGAATTCAAGGTAAGTGGTCCAGGATACTCAACTGAAAAGTCTCGCCTATTTATACCA
GAATGTAGTTAAGTTGCTTTCCTCATAACTGGTAATTAGATAGTTAACATACCACTCAAT
CAAGAGGCCATCTAAGGAGCATCAATAGAAGCAAAATCGTTAAAAGGATCTCCTCTTTGC
ACCAGATTTGTAGGGAAAAATATACTTGCTACAGTAGATTCTCAAAATAATTTAATCTTA
ATGAGTTAATAACCACAAAAGAATTAAAATAGTTTTAGAAATTCTTCTACTTCCATCCAT
AGTATTCCATCAACTCCAATTTAATAGTCATTAAATGAAAAACCTTAATTTTTAACTCTT
TCATTATAAATATAAGAAGATTTATGCTTGCATTAATAATACTCATCCAAACTAGATTAG
TTTAAAGGAAATCCTTTGTTTCCATAATCTCCTCTAAAATAATAAAGTATCACTTAAAAT
TTATCTCATCCTGAATTAAATATTTAAGACCCAAAGTAAATAAATGAGCTTAAATCTTTA
CTGAATACATATCCTATTGGTTCGAATGTAGTACGAACAGACTAAGGAATATTAAAGAGC
AGTATTTTCGATTCTTAGACTAAATTAAACGTTAAACATACGTTTTATTAGAAAGGATTT
ATTTATTTCACAGAGCCAACATATCTCAGCCATCTAACTATTTCTTTTAATTTTTAATTA
CAATAATTAATTTAAACAAGCACAACTTCAAACAGCTAGAATACTAAAATTAACTCTAAT
ACAGACCTAAATATCGCATAAAATATTCTTAGTACTTCTATCAATCCTTCATTATTATTT
TAATCTAATCTTAATCTCCTACCGAATTTTTAATTTATAGATAACACAAACCAACCAAAC
ACAGCAATTCAAAAAAATAATCAAAAATTACTTAATATCCCAAGTTTACAAATTTTTTCA
AATAATAACAATTAATAAAATTTCACAAGTAGTTTTAATAATATTTAATCTGATTATCTA
AATTTGCCTTACAACACTGAAATTTTAGATGATCCTTCTCATTATATTAATAATTTAAAT
AATAAATTTCCTAGAAGTTCATTTATTGATGAAGGTGCTAATAATTAAGATTAATAATTT
CTTCATCTTCCTTTAACTTTAGTCTACCAAGTAGGAGCATCCTAATCCATTTAATAACAA
GAATCACTTATCACCTGCCCTAATAATGAAAGTTTTGTGACTAATTATGCCAAACCCTCT
TTTACTTTTAGACATTTACATGAAAAGAGAATGATAATCGATTTTGTAGTAGTTCACTCT
ATAATTTCTTCTAGCAAAGGAGCCTATCCTATTGGCAGTGGATTAATTTTCGTTGCAGAC
AATATAAGTTTTTTTGATATGATAGATTCATTTCATGGAATGAACATGGCAGGTTATAAT
TAATGGAAATTATAAAGAAAACAAATAGATACTCCTCTACAGTAATGGGAACCTATTGGA
TGCTTTGAATTTGTTAACAATAAAGAAGTAATCAAAGTGGAAATGGATGTGAAAAGAGCT
GCAAAATTTGTGCATTTATTACCAACTAATTTTAGAAGTTAACCTGAAGATTTCACAGGC
TATTTTAAGTCAGGAATATTAGATATATAATATTTTGGTGTTTAGGGTTAAGTATTAGAG
GAAGACACCTCATAAGACGATAATTATGTATTTTATGAAGAACTTAGTAATCAAAATTAT
ATATGCGAAGCATGTAGGAACGAAAAGGATAGATTTCCAAAAAGCTAAGAATTCACTTAA
GAACCTCAGTTTTTGCAATTCTAGCAACAATAAAAAGCAGAATTTATTTTTAATTAGCAA
ATTTCGACTGATGAATTGATTGATTCAGGAGTTATCAAGATTGAAGTACAAATTGAAAAA
GATAACTCTTGGCATGAGCTAAACTCAAATAACATTCTTATCCTAAAAAGGTTAAACATT
AATAATCCCTTAGATAATTATCCTATTTCAAAGCTTCCTAATTCTTTACCTTTGTTAAAT
CAAATATTAGAGTCTAAATATAATTTATTTCCCAGCAAAAGTCTAGATCTTAGAATTTCT
CCAAAGATATTTTTTGAAAACAAAATTATAGCATTAAGAATTTAGTTAAATTAAAATGCA
TCAAATTTGATTTATTCAAATTTCTTTTAAAATAAGAATGTTGTTGATAGCTTTGTGCAA
TATGCTTTAAAAGATTTTTCTGTTGAGTGTTTTTAGAGCAAAGATGACTGCTTAATTAAT
TTAAAGAAAGAATAAATTCAAGAATATCGTCACACTCTCTTAGATCCTGAAAAATATGAA
TACTTGAATAAAAATATTATCAAATATGTTCTACTCTAAGCTCATAAAGCTAATAGCGCT
GAAAGTGAAAATCATAAAGAAAGAAAGCTACAAACTTTAAAGCTACTCACTAAATTAATG
AAAGTCGAAAATAGACTTGTGTAACTATTTTATAAAGATTTAGACTTAAAAACATTTATT
GAGCTTATGATTTTTGAATTTAATGATGGTTGCTATGAAAGTTCTAGCTTCAGTAACTAA
TATACAGAAAACTTGAAGGAAGTATTTGAGTTTTTATATTAATTTAGAAGTGTTTTTACT
TTTGCTTCAGATTTAGAGTAAGTTTTGATAGATTAAATATCTTCTAATATTTTTGATAGC
AAAAAATACTAGGAAAACCTATCAAATAGTAAAAATTATGATTAAAAAGATCAGAAATAA
GTTAATTAGAGAGGATTAAAGCGTTTCTTTTGTTTACTAAAGTGGTGTTCTAATATTTTA
GGTTAATAAATATTCGATAAGTTGCTAGAGCTTTTACATAAAGTAACAATTTAATTTAAA
ACTCAGAAGAATATCAATTATTATTTACTTCGCTATGAGCATAATATTGCAGATTTTCTT
TTTGAAAAACAATTATTTACAAATAAGTTTGTCTCGTAATACTCATAATAACTTTAATAG
TCTTAGAATAAAAATTTCAATAATCTAAATAGCAATTAATAAATTTAAGGAGGATCATTG
ATGACCAATTCTATATAACAAGGCTTAAAAAACGAATAAGGGAATAAAAATTTTTCAAAT
TTGTTAAATAGTGATTTGGTAATTAAAGAACATTCTTTGGAAACTTCCTCTATTTAATAT
CCATAAATATCAGTCTAAAATGCCCTCAATTTCAATGAAGCAGCTTCAGCATCTACTTCT
CTAAAATTAAATAAGGCACTTGTCAAAGATAAAGAAAAGAAATCGAATGGATAAAAAATC
AACGAATTTTTGACTGATTAAATATTTGTTGGAGATAAACAAGATAATCAAGAAATATTT
TTAACTTCAAAATAAAAATAACGTTTATTGAAAAGTCGTATTCACGCTGATGTGGATGGC
AGCACTAATAAAATATATACTATTGATTTAATGAAGTATCATGACATAAAAAACATTCTT
TTGACATTTGACAAAGTTTCGAGATCTTGTGCTGTAAGGATGAAAGTTTAAATTTACAGA
GTTCATTAAAATTATTATTATGAAAATGGATTTGAAAAAGTTCTCATTTATTCTAATGAT
TATTAAACTTGTGTCACTAATTAATTAGCCGTGTTAAGTCATCAGCATGAATATCAAAAT
CAATATTTTAACCCTAATTCTTAAAATTTGAACTCTTTAGGGTTTAGCTATTTCGAAGGA
GTTACTACAAGATATTTAATAGTTTAGCTTACTTTTGCATTCGTCCCATATGCATCCCAA
TATACTGATATAGAATAATCGGCAAGGATTGAAGTAATACCTGAAGTTTTTGGTGTTATT
TCGTAAGATTAGAATATCAATACTCCTTTAAAATATTTCTAATAGCTTTTTGAAGGTAAT
AGGATAGAAGAATTAAAAATAATTAAAACAATATAATTAAACCCAGGTTTAAATCAATTT
AAAAAAGTTTAAATATCATTCACAAGCTTTTATTTAGATAGCTTGAATTATTATGAGCAG
TAAATTGAACAAGTTTTACAATAGAACAGCAAGAAAATACAAAATCTATTAGTATCAACT
ACTTAAGGGAATGTACTTGGTACTAATTTAACAAGTAGTGTTTATTTCAACTAATCATAA
AATGCAGGTCACTTATTTAGTCCTAAATCAAACAAAAATAGTCTTAATTTAAGTGTCGCC
AAAAATAACTTAAGCGTTTCATAATAAACATAAAACATTCCTAACATTTAACAAAACTCA
TAAAATCTTACTACTTCTAAAGCTAGTTAAAAATCTTTAAAAAAAACAAATGAAAGCTAA
GAACTTGAGGAAAAGCTTAAATATGTTAGTTACAATTTTTTTTTCACATCTTCATCTGTA
TCCAAAAAGAAAAAAGAAAATAAATTGAATAGTGCTTAATCAAATGTGGAACAAAACAAA
CCTAATTCGGATTAAATTAAAACAAATTAAGAATAAACAAAACTTAATATTGAATAGAAT
AAGACAAACACTAATGAGTTAACTAAATCGATTAATATTTCATAGACAAATTTCTAACAG
CATTAAAATGTGTCCTAACCACCAATGTTACTTTCATCTGCTTCTTAAATGCTATATCCA
AACAGTGGATAAATGAACTTACAAGATGATGATTTGGACAATGATGATGACTTATTTAAC
ATGATAACATAAAGTAAAAAGGAGGACATAGAAAGATTAGAAAAAGATGAAGTAAAAGAA
GAAATAGGAGAGGATGATGAGGAATAATATGGAATACTTTCATCATAACTGAATAATGAT
ATGCAATATGACATGAGATAAGATTTAATTAATTAAGTCCAAGAATTGTAAGATGAATTA
TCAATAAGGCTTATTAAATACCATGAAAAAGAGAAGCATCATAAATAAACTGTTGAAATG
AGTAGCTCTAAAGTATAGAATGATCATAGTTAGAGTTTTCCCTCTTTTAAAAACTTTTCA
TTTTAACATTCATAATATAATGAAGAAAGGATTACGAAATTAAAATAAGAATAATTATAA
ATATAGCAGCTATGTAATTAAATTAGATAAATATAACTTTAATTGCTTAATTTAGAAGAA
TAAAATTAAGGTAAAAGTACTTCAGTATAAAAAAATAAGCAAAAACAATAGACAGATGAA
TCTAATTAATCTCTAGATTTTCTTGCATGTCTTACATATGAGCTTTGTTCTTTCCTTAAA
TATGATGAAAAGCTTATATTCAGGCTTATTCAAAAAGACTAAAAACTAATCACTGAAAAT
CAAATTTCAAATACAGGATTAAACTCAGTAAAAGAAGAAGATATTTAATATTAGAATGGC
TCTCCAAAAAGCAGCAGTGATGAAAGAAAATTCTAAGATATAAATTGGGAAGATGATGCA
CAAGAGGAAGAAGAAAAAAAGCAGAACGATTAAAAAGGCTTGTAAGAGGGAGGGTCATTC
CTTGTTAAGCTAAGCTTAGAATTATTTGATACCTTCATTGTGAATGAAAGTGGTTTGCTT
CATAATGAAGTTAAAGCTTTCTTTTAAGATATATTATTAAAATCAATTAACAGGCTAGAT
ATTAATAAAATCCTCAACTAAATAATAGAAAAATATTTAATTGAGCCATTCTTACAGAAG
AATTTAAATAGTTATTAGTAGCACTAATCCATAGAGGCAACCATAAATTAATTAAAAGAA
AGCGTCTTAAAAAATAATGGTCAGTTTTATTCTGCTTCAAAAATAATTAATATAGTTAAC
ATTTTCAACATTGTAGATGTGAATACATTTTTCTTAAAGCTGAAGGAAAAGCAAGAACAA
ACTGAATTATTTTTGAATACCTAAGACAATTAACAGTAAAATGGCTAAGTTTCAAACCCT
AGCTCACAGAATTCCTAGAAACTTCAAGAGCTGCTGTTATATGTATGGAGCTTAACTTCA
ATGCTTAAAAATGAATACCTGAAGATTTAATTAAGATAGATATTTACCTAGCAAAGAAAT
TAGTAGTTTATTTAATAGTAATAATAATTATTTGAAAAGTAGTTGAACGAAGACGACCTC
AACAATTAAGAGAACTGTCAAGGATTGTACATTTGCTAAAATCTCATTAGATTTTTGTTA
TAAAATTCTAGCACTATAGCTGAAAAAGACATATCTTCTTTGCTTACTCATTTGTTTGAT
TTAATGCTTATGATTATCAATTGTGTCCCACTTTCACACATTTCTAAAATAACATAGCTA
TTTTTTTCATCTAATATCACAGGATTAACAAGCGCAACTAAAAAATAAGAAGAAAAGTAG
TAAGGAATACCTCTTCTTTATAGTATTTTCTTCAAAGCAATGTCTTTAAACCATTAACCT
TTGCTGCAGGTTTTAGAAGTATTTATAACAAATCTAGTTTTTCCTAAGTAATTGGAGAAC
TACTCAGAACTAACAATATGTTCAACTCAGCCTTTAGCGAAAATATAACTAACAGAGGAA
CTTGATAAATATTTAGAGACTTAGTTGTAAATACTTTATCACTTATAGTAAATGATAGGA
TATTTGCTAGATTATCCTAAAAACTGTAATAGCTCCAGTCCATACACATAAGTAATATTA
TCATCAAACGCAAAAACACGACTACCTCTTAGCAATTGGATTGGTCATCTGAAATTCCTA
CTTTAAATACTTTAAAACTCATCAAAGAGTATTGTTTTAATACATAAAAAAACTTAAAAT
TCTACATCTAAAAAAATGTAAGAAATATAAAGAAGAAAAACATCAATTTCTTCTAGGAAA
AGCTCTTTAGCTTCAAGAAAAAATAGTTGTGGGTTGGATTAATTAGATCATGCACCTACT
AATTTAACAAGATCAAAAACTACTCCCCCTAATAATGATTTGCAAGTTTTTAACTTATAA
TCCAATAGCAATTAAATAACACTAGAAGAATATATCGATCATTGCATATTAGACAAGTAG
TTGTTAATTTAGACAAATATTGCATTAAAATTAGTTGATCTTTTGAATCCAAAAGAAGAA
TAGCCAGAATAAAAAAAAATTGATGAGGTTGAAGAAGAAGAGTTTGAGGATGACATAAAC
GACGCAAGCCAAGAAGCAATTGATGATAAAGAAATAAAAAATTTTTATAAGTTCTAAAAT
AACATATAAATTTGGGGGCTTATCATGAGCACAGCAAGCTTATTAAAAGGATAAATATTA
TAAGAAAGCAACATTTATACTAATTTATTAAATTAATATTTAAAATCATCAGATGAAGTA
AAGTCAATCTATCTTAAAAGTTTTCTTAATTTAACAAAGACTATTCTCTAATCAGGCTAT
CAGATAAAAGAGTTTTGTAATGACCTCTTTGTAATAATTTTTAAGATAATCTTCAAAAAA
AATTCTTCTCATTCCAAACTACTTGGCTACAAAAAAGATTCTGCTAACTCTTCATAATTT
TCAGAATCACCAGAATAACAAAGAAACTAAATTTTAAACAGTAAAAGCTTTATAGAGGAT
TAGAATCTCTATTATCTTGTTAATGGATTACTCGAAATTCTTCTGACTAAAGAAACTCCA
GCACCTGAAGAATTCTATTAAGCTCAACACTAACAAAAAGAGTGGAAAAACTCTTTTTGC
AAATTAAATGCAAGGGGAGCGGCTAGACTATTTATTGGAATAAGCAAATTCCTCGTTAGA
TAATTAAATTTTGGTGGAGTGGAAGGTGTTCATATGGCAGATGAGATGATCATATCTAAA
TTACAAGTTGCAGATTATATATTAAAAATCTTACTCTCAGCTGAATCTTCATTCTAGCAT
CTAGCAATAGTTGAAGCTTTAAGCAATTGGAATTTAGTAGAATTTTTAAAATCTTCATAT
TCAAGATGCATCATTTGGTATTTTTTCAATAAGCCAGATGAAGTGATGAAAGGAGTATCT
CCAGCTACTATTTTAATAAAATCTATAGGAAATCAAGTATTAAAGCTCTTTACTATTGCT
GGTGAAAAGTAAAATATAACAGAGATCTGCATTGAACTTCTTTTTAAACACTCAATGATA
TTTTCTAAAGCATTATTTTCTAATATCCCTAAATTAAATGAATAGTAAAGTGAGTTTGGA
ACAAGCTAAAATATTTCATCTGCTTCTCACATGCATTCTCACTTTTCAAACCTCCTTCCT
TTTTCTAATCAGCTTCAAAATTAGGATATTAGTGTATTCAATCTGACTAATATGTCTATT
ACAAATTATAATGCTCTAATACTTGCTACTAGACAAAGTAAAATATTTTAAGAACTGCTC
AACCTTTGGATTACAAATGATTCACTCGCTTAATTTCTAACCTTCAAAATAAACGGATTC
TCTCATCTTTTAGACATAATAGGTCTTAATTCTTTTAATTAGGTTCAAAGCTTAAACGAT
TAAAGTAAAACTTATTAGTATAGCTCTCTGAATGAAATAAATACAACAAATATGCCTATG
TTTGGAAATGAAGATTCTTTATTTGTAAATTAAAATGTGTTGAATTATATTTCAATAATT
TAATCTGGTTCTGATAAATAATTGCCTACATAGTCTAGTTTGAACAATTAAACGATTTAT
AATCCATGGAATCAATACACAATGTAAAATATTTCATCTGCTCATAAAATCCCTCCTCCT
TCACTTTAATTTGGAAGCTCTTCATTTGCATTAATCAAGAATCCTTAGCTCGCTCCTTTT
AATAACGGAGATAAAAAAAATCTTTTTTTCCATGATAGCGCATAGAATTTGAATAGTCAA
AATAATTCTCATATTTAAATTCAATAAAATGTAGCATTAGCACCTTTTATGACTTAAGGA
TCTGGTGCAAGTTCTTTTGAACCAGCTGGATTGCTATTTGGTAATAGCGAGATACATGAA
AACTAAAAGAGTAGCTTTATTAAATATTAAATACAACATCCATCTTATGTTAATAACTTT
AATGCAACAAACAATAATTCTTTGAACTCCCATAACATGAGCAATAGCAACAACTCAAAT
TAATCATTCCCATAAATGATGAATAATCCTCTTTTTAGTAAACTTCCTTCTAACTTGAAT
TTTTAAAGTACAATAAATAATGGAATTAAGAGCAATCACTCTATAGTATCTCCTGGGGTT
ATTTCAAATACTATCCCTTAGCTACCACCCATTCCTCCTATGTAATACAATAACTATAGT
AATAATACTATAACTCCATAAAATATAATTTAAAATAACTAAAATCCCTTCATCAATTAG
TAAATTTACACTAGCTCTAGTAGCAGTGGAAATAACACTATTAACTTAAATCCTTTTACA
TAAAACTTTTACCAATAGTATCCTACTATTCCTCTTAGCGATCTTAACGATTCCGATATA
ATAAGCTTAGCTAATAATTTATAGCAAGATTATTTGTAATAAAAATCTAAAATATACGAA
ATGAACAACCCTTTGAGAACAAATGTTACAAATCAAACTGTAGACCCTCTTTAATAACTA
GTAGAAATAGAATGCTGTAATTAAATACAACTTATCCCTTTGATAGGATAGAATTTTCAA
ATAGCTTAAGGCATTCAAGATTGGTCCTATAGCAAGAAAGGTTGCAAGAATAAAATTGCA
ATCCATCTCCTCTCTGGAAGCTAACATTAAGAACTTTAAGTTCTTTTAAAATTAAATAAA
ACAGTTGAAATTAAAAAATTTAAGATTGGATTCAATTGCTAGTCTGTTGAACAATCAGAT
TCACAAAAAATTATTGGAATACCAAGCGGAGTTATTGTAGAAGGAGGCTTATCTGAAAGC
AAATTAGTCCCTTTAGGTTTCCTTCATTAAATTAATGATGATAAATACTTGAATTTCGGC
GTTAAAGTATTTGCTAAAAATTTTGCTAGAGTTAACGATGAGACTGGAAATATTGATAAA
TGTATTAAATCTTTGTCATCACCTAAGGTTAGCTATATTAAATTAAGAATTATTAGACCT
ATTATCACTCTTATTGAAGACTCTTCTTCTTTTGTAAATAAACAATTTGGTAGTATAGCA
ATATCAATTAATTTCCTATCAATCATTGGCTATTAAGTAGATCACATAGCCTCAAATTTG
TCCTAATTTATTTACAAGATATAAACAGACAGCGCTATATAAATCTTAGGAAAATTATGT
GCTGAAGGTATGGGATTTGACAAGACCATATAGTCTATTTCGAATGATAAGCAAATAATT
TAAAAAATAAAAGACGGATTTGAGTGTGTAGAATCTTTAATTTCTCAATATGAATAGCCT
ATATCACAGCTTTTGATTTGTATAGCTTTGAACAATGATGAATTTGCAGATTGGATATTT
GATTATCTTCTTGATTCAAGTAGAAATAAAACTCCATTGGCAAAGCTCCTAACTGAAATA
ATAATATCTTAAAAGTAACAGTACAATGACAAAGTGTTATCTAACAAAGCTTTGCCTCGG
GTCGAAAAGCTTTATGAATACATAGTTAAGCAGATTAAATAATATTTGGAGAGTAACCCT
ACTGATAAAGATATAGAGGTAGATGCAGATGGTATTTTGTCTCTTTCAAGTATTTTCCCT
TTTGTTGATGCATTAATAGCTGCTTTAAGAATTTCGTATCCTCATCCAAAGATGAATCAA
AATGAGAAAGAAAAATATCAAGTAAAAGAAATTATGAAATTAAGAGTAAATATAGAAATC
ATATAAAGTCTAATTTCCATCTATTTAAAGTGTGTTAAGTAGAAAGCTGAAGGTTTTTCA
AAATTAAGTATAAAATTACTGGTAAGCTTGTTATATTTACCCCTGCCATTTTACTGTGAT
AATTAGGAAAATTTGATTAAGGAATCTCTAAACTTAATTTGGGATTCACTAATTTAGAAA
AAGTAATATTAACTTACAGAATTAATGGTTGTCTTAGCCTACGGAGGAGATTAATGCCAA
AGATGGTTTTTAGAAGACAATCAAAATCATTTTAAATAATTAATTCATAATATTAATCAA
GAAATGTCCTTAGCTTCTTCAAATGAAAAAAATACATAAAATAATATTTTACAATCATAA
AATCTAAATAATCAAACTATAACAAATTCTAAGAAAGCAAAAAGTCTTTTCAGTATATTG
TGCGCTATATCTAATTCTCAAGAAATTTAAAATTTGCTTATATAAACCTCACCTGGAAAC
AATAGCTCAAACAATACTAACTAAATTCCAGAGTACATAAAAATATATTCATTGATGAAG
CTCAAAAAATCAGAAAATATATTTTTTTCCTCTACTTCTTCAATAGGATCCTCAAGTTAT
AGATTACTCTAAAATTGGGTTGACTAGGAGTTTTTGCAGTTATTTGTGGAGTTTTTGAAG
AAAATATCCTACAGTAAATAAGAGGTGATTGATTCAATTGTGCATGGTCTGATTGAAGAT
ATTAAAGAACTAGAACACAAGAAAGATCATCTATTTGTTAATGATTTACTTCTTCCTATT
TTACAATCTATCTAAACAGTCCCTATGTGCTTTCATGCATTTGATTCCCTTCAAAGAAAG
TGGCTAATTAATCCTATAAAAGTATTAAATCATCCTTATTATCTAGCCAAATTTTAGTAG
TCATCAAAAAGTAAAGCCTAAAAAAATATAGATAAATTCAATACTAAGTTATTTAGTCAA
GAATAAAAGTAAGTCTTTATGAAAACATTGAAAAAGTTCACACTCGATACAGGCCTATAC
AAAAAAATTAAAAAGTATGAATGGATTAAAGAGGCAACTTAAGAAGTAGATAGCTAATCA
TCATTGATCAATAAATTGGAAAATAAAATCTTAAATAATCCTCCCTACATAATTGTAATT
GAAGGTGTCAATAGCGGATAAAAGTGTTTGTGTGGTGTTTTTAGCAGCTAAGCCATTTAA
AAATCTTCACTGGAAAGCACTTTTAATATATCAAACGGAGATGATTGCTTTATCTTTTAC
TATAGTGAAAATTATCAAATTCATTTCAGAGTTGAAGGCAACGATTTTGGGTAATTAGAT
GTTTCTCCAGAAACAAGTTTTTTAACCTTCAAATATAGAGAGCTTGATCGCATATATTTG
TCATTCTCAGAAGGAAGCTCCAGTTATGTTGATATAAATATGTTTGATATGAAACCTATC
GAAAACAGTCAAAATATTCCTCACGATATTCCAAACGATTTTTCTTTCATAAAAGCAGAG
TATTGGGTTTTAAGACCATAAACAATCGAATTAAGTGAAGATAGGAAACATCCTTTTAAA
ATGGAAAATATGTATGACATTTAAAATACATAACACCATCTGTTTAACAGTGAATATTAC
AAACCTGACAATGCTTACAATTTTTACAGATCTCCTGCTGTTTACCATTTCCCAGAAGAT
CTTACTTTGCAACAGGTTATAACATAATTAAATGTCCCAGGTTTACAGGTATCCAAAGAA
GTTCTTTAGCAATTCTCCTTCAATTTAAGATAAAGTGCTAAATTTTTTTCATGCAAAGAT
AACATCAATCTTAGAAGCCTTTACCAAGAAATAGATAAGAATTCAAATGGAATTATAGAC
TTAGAATATAATGTTGATTAATTCTTCCAATAAGCTCCTAAAATTCAATAGCTATCATAG
CCTCAATAAATAGAATAATAAAATTTAGATAATCAAAAATAGAATAAGATAATTGATGCT
TTTATAGATTAGAAAGGATTTAAAACTATTATATCTGTTATTAAAGAATAGCTAAATAGC
TGGAATAGTAAAACAAGAGCTAAAAAATGGTTAGTTTATGTTCAAGAATTAAATACATTC
TCTGTTCTTCCCAACTTCATTTATGAGTTTATGAAGAAAAAGGAAGGAGTGAATATACTT
TTCCAACTCTTATCTGGATCTCTAGATTCTTCAAACGAATTAAAATCAGAAAAATAAGAA
GATAATAAGATGCATTAAATGAAATAACCTTTACTAGATGGGCTCTCTGAAGATTACCCA
ATCACAAAAGCATTTAAAAAGAGTTATTACAGTTAAGAAAAGAATAAAGAAGACTTTGAG
AAAAACAAATAATTTGAGGAATAAGAAAGAAATGCAGTTTAAAATATTTATGAAATTCTT
TCATAATTATTCTAATAAGATAAAGATAATCATAAAATAAAAAGTATTGCCATAGAAAAT
AATATATTGTAGATAATATTTGATAGAATTTCTTCAGTTTCCAAGGAGAAACCTCGTAAA
TTCATTGAAAATACTCCTGCCTAAGATAAAAAGTTGAGCGATGATGATAATAAATTAAAA
TTAGACTCTCCTATCCTTATTATGGGAGTATAAAGAACAGGATAGGGAGAAAAAGATGAA
AAATCTCGCTCTAATTAGAATGTGGACAAAAAGAAAAAGGGTACTGGATATGCTTCAGAT
AATACTGGATAAAACCAAAAGTGGAATACAAGCGAATATGTAGAGATAAATAAATCTAGA
AATCAGCTTCTTCTAAGTTTGATGAAAATATTATAAAGCTTCTTTAACTTTGAAAGCTGG
AGTATTCCAAATAAAGTAATTCATTCTATCTGTGAAAGTAGTCTTCTTCCATTATTAGAG
AGCGCTTTTAGGAGTGGCTCTTTACTTGAAATATGTAAAGAAAGTTAATTGATGATATAA
TACTTGCAGCTCATAGAAGTGATGTCCTAAAATAAAAGTTTGATTAAATGTCTCATGAAA
CTTGACCAAAGATACCAGCCTACATAGACTGAAAGTATAAGTGAACTTCTAAGTAAGCTT
CGTACTACTGCAGAGATATTCTTAAATTGCATCAAACCAGTACAAATATAAGTACCTGAA
AGTACAGTTAAATCTTCAATATCTATATAAAAAGACATGCTAGCTCAATCAAATGCTAAT
TTATTAAAATAATGGGGAGCTGATAAAGACATATTGAATGAAGAAAAGAAATTTTAAAAA
ATCCTGAATGATTAAGAAGAAGGCAATCTTTAATCTTAATAAGTTGCTACTAGTATAATT
TAGGTGCACGAGAAATTAGATTAAGCTATTCAAGAATTTAATGAACATATTCAAGAATCA
ACCTCACAAAATTTTTCTAATTTAGATCAAGAGTAAGATGAAGGATAAGAATAAATCTAA
AAAGTATAGCGTGTTTTAGAATTACCTTTGAATGTAAAGTATAAAATACTGTTAGAAAAG
CTGAGATTCGGATATTTTTCTATGAACAACAATAACTTAAACACATATAATCATCACTAC
TAATAGTAAATCATGCAGAACTAAAATCCATCATAGGTTAAAATGGTTAGATTAGCATAA
GAAATTGCAGATATGGCTAATTCTTTACCAATTGATCATACAAGCAGTATATTTGTTAGA
TGCGATTCCAAAAGAGTAGATGTCATGAAATGTATAATCATGGGTTCCTCAGGAACTCCA
TATGCTCATGGTGCTTTTTTATATGATATTTTCTTTGAAGACTCTTATCCTAATACATCA
CCAAGAGTTAATCTTTAAACAACTGGCAACAATAAAGTGAGATTCAACCCAAATTTATAC
AATTGTGGAAAAGTTTGCCTTTCTTTATTAGGTACTTGGAAAGGATAAGCCAGCGAAAAT
TGGGATCCAAAAATAAGCACTTTGCTTTAAGTTTTAGTCAGCCTTTCAGCTATTATCATG
AATGAAGACATTTACTTCAATGAACCTGGGTATGAAGGACATAGTGGAACTGAAGATGGA
GATAGAAAAAATGAAGCTTATTCTAATATTGTGCGTTTTAGTAATATTAAATATGCTATG
ATATAAACCATAAGAAACCCACCTGAAGGTTTCGAAGATGTAATTAAAAGACATTTCTAT
CTTAAGAAAGATGAGATCTTAAAAGAATGTGAGGGATGGATAGAAAGAAGTACAAAAAAA
TAAGCAAGTTATGTTGGATTGGTCAGTGATCACAACCCTTAAATTTGTTAAGAATTCAAA
TAGCCAAATAAATATACTGAATAACTCAAGCTAGCAGTTTAAGATTTGAGGCAAGAATTA
GAAAAACTAACTCCTCCATCTTCAATAGAAACTTAAGAGGAATTAGCTAAGAAAAAAGCC
AGAAGCCAAAAACAACATGAAAAGAAATAAAATTTAAATAAATAAAATAATTAGAAATAA
AATATACCAACAGCAGTTTTACACAATGCTTTAGACGATTTATAGTAACAAGAAATACCT
ATAAAGAATAATAAAATTAATAAATAAGAAGAGATTGATGTAGAAAGTGAAGAAGTAAAA
GATAGATGGTCAAGATATATTTGCGCTATGGGTATAGATGCTGTAGCTAAATAGAGTAAA
TGCAACATTTTCCTGAGTGGTTTAGGACCATTAGGAGTTGAGATTGCAAAAAATATTGTT
TTAAGTGGTGTGAAAAAAATGACTTTGCATGATAACCATATCGTAAATTATAGAGACTTA
AGTGGACAGTTTTTCTTAAAGAAAGAATGTGTTGGCAAAAACAGGGCGGAAGCTTGCCTA
TAAGATATATAACTCCTCAATCACTATGTTCGTGTGGATACGAATGTTAATTAGGTTAAT
GCAGATACTTCAACATTATTAGAAAAGTTGTATTTATAAGATTATCATGTAGTAATTATA
ACTGAGTGTTATTCTTTAGATATCCTTACAGCAATCAATACTTTTTGTAGATCTAGATCT
ATTAAATTTATATACACTTAGGTTTAGGGACCTTTTGGTTTACTCTTCAATGATTTTGGA
GATAATTTCGAAGTAATTGATAAAAATGGTGAAGATCCTGTTGAATTAGTTATTTAAAAT
ATATAATAAGTTTAGGCTGGTGAAAAAAGCAATAAACTTAAAGTAACTTTATTACCTGGC
TTTAAGCACCCTTACGAAGATAAAGATAAGGTGATTATAAAAGAAGTACAGGGTATGCAA
GAAGTAAATAACTAGAGTAAATCAATAAATGACTCTATTTTCGAAATTGAAACAATAAAC
TCAAATAGCTTTTATATACTCACAAATAATTTATACTCACCATACTAAGGAAGTGGAGTT
GTTAAAAATATTAAAACTCCAATTTATCTTTCGTTTTAGTCTTTAAAGCAATGTATTTAG
GCAAATAATATGGAATATTTTGATGCAAATATGGCTTCTCATGATTTTGAGAAAATGGAC
ACCATACCATATCTCCACATTGCATTTTAAGCACTTTAAGAATTTATCCAAATAAATTTC
AGGTATCCTCACCCATGGAATTAAAAAGATGCTTAAACTATGTTAGAAATTTCTAAAAGT
CTTTATGGTGCATTTGACATTCCATAGAAAGAAGATGAAAAAAATAAATTAAAATTTGAA
GAATACATAAACAAATTCTCATTTACTGTATCAGGAACTTTTCATCCTTTGTGTGCGTTT
ATGGGTGGATATGTTTCTCAGGAGGTAATTAAAGCTATAACAAATAAATTTGTGCCTACA
AAATAACTCTTCTTGACAGACTGTATCGAAGTTTTACCAGATATAAACTGGAGCGATAAA
AAATCTTCTGAAGAATAAATTAGTAGATTGTAAAGTTAATTTGAAAATGAAAAGGAATTT
GAGGTATAAAATGAACTGTAATTAAAAATTGTAATTGGTAGCGAAACTTCTGAGAAACTT
TCTCATTGCAAACTCTTCATGATAGGCAGTGGAGCGATCGGCTGCGAGCTCTTAAAAAAC
TTTGCTATGATCAACCTTTGTACTGGAGAAGAAATTCCAGAAAGAAATTTGAGGAAAGGA
TAACTAACATTAACAGATCCAGACCATATTGAAACTTCTAATTTAAATAGATAATTTTTA
TTCCGTGAAGAGCATTTAAGAAAACCAAAATCTTCTACAGCAGCACAAGCAGCAATTAAA
ATGAATAATAAGCTTAAAAACCATATTGTAGCTTGTTTGGATAAAGTCTGCGAAGCTACG
AAAAACATCTTCTCTGAGGAATTTTTTGAAGATTAAGACATAGTGGCAAACGCTCTAGAT
AATGTTGAAGCCAGAAGATATGTAGATAAAAGATGTGTTTCTTCTAAAACTCCTTTACTT
GAATCTGGAACTCTAGGACCAAAAGGACACGTTTAAGTTATCATTCCTTATAAGACAGAG
TCATATGGAAGTCAGTAAGATCCATAAGAAGAAGGTGGAGATATTCCTCATTGCACTCTA
AAAATGTTCCCTGAAGAAACTTTACATTGTATTGAGTGGGCTAGAGATAAATTCGGAAAA
ATAATTACTTTAAAGCCAAAAATTGTATAAAAAACTCTAGATGAGATAGAGAATATCAAA
GAAGGAAAAATTAGCTGTGAAATAATTAATTTGAGAAAGACTCTAAAGGCACTAAAAAAT
AGACCTCTTTCATTTGAAGATTGCATAGAATACGCAGTTTAGAAATTTTATAAGTTATAT
AGAAACAATATAAGATAACTTTTATATACTTACCCTCTTAATCATAAGAACAAAGATGGC
AGCGATTTTTGGAAATTACCAAAAAGAGCACCTTTCGAAATTTCATAACTGGATGAATAA
AATCCTCTTCACAGAGACTTCATAGTTGCATTATCTGTAATGAGAGCAAAATCATTTAAT
ATTCCTTATCCTTAGAGCTTTAGGTAGCAATCAGAAAAAATATAAATTATGCAAATAGCT
ATGAATTGTAAAATTGCCGATTTCTAACCATCAGATGAAAAATCTACTGAAATTAAACAA
GAAGTCAATTAGGAGAACGATAAAACATAAGAATAAGCTAGCATTAATTAATAAGAAATT
AGCCAGATACAAACAGAAACTAACTAAAATAATATAAATGAATTAAAATAAAACTAAATT
ATTTCAAATGATGAAAATCCTAATTACCTTATAGAGTAAATCCTACTTTAAAAGTTAAAT
CTATAATAGTAAACTTTTATGCATTCTGAAGAATTCGAAAAAGATAATGACTCTAATGGG
CATATTGATGCCATCTATGCCATGGCAAATCTTAGGTCCATAAACTACTCTTTAACTCCT
ATGGATTGGATTAATGTTAAATTGAAGGCAGGAAAAATTGTGCCAGCGCTTGCAACCACA
ACTGCAGCAATTGCTGGATTGCAAACTATAGAATTAGTAAAAACATTAAAGAAGGTAGAT
ATATGCAAAATGAAAAATGCTTTCCTGAACTTGGCTGTACCTTCTTTATAACTTACTGAA
CCAGCAGGTCCTCCCTCCTTTTAGATTACTAAAAATTTAAAAGCAAGTATTTGGGATAGA
TGGGATGTTTGGTTAAATAAGTAAGATAGCCTAAAAAAATTATTTAATTACTTTGAAGAG
AAGATGTAATTAAGTCCATTTAGCATTTTAATTGGAACAGACCTCATATATTCTTTTACA
ATGAATACTGAAGATAAGTAATTTATACAAGATAGTACATTTTCTGAGGTGCTTAATAAC
AACAATTAATTAATTTTAAGCGAAGCTAAATATATAGATCTAAATATTTTATTCACAGAA
TTAAATGGTAATCAAATTCTTCTGAACACTCCTTCTGTAAGACTATTTTTCGGTGTTAAG
GAAGAAAAACAATAATGA


>TTHERM_00028560(protein)
MKTSYSEKVIADISKCSDFTYDSKNQELIFIDSCLSLKSIRVIENSESQIINWKDVNIQI
LHNGQQDLSPQLQSSQNVNFLSSQKATQFDNNEKQQQSITSQPALIENQGIELDIQEQAN
QLNYSSARMIPYISQQTANLPANQQNKLLFSNSGLTVTCMDTSPQIAISTIGFCEGEHFW
EFYCPIYCQKIEMGIIAPSIQQFHLIEFHTTTPRQVTFRLNFNTCKLSTYLNGNLNNQKS
QILSFLKPLSDQNAVSSESNSQQIMWFPAIKMKEVGVSVIFNPFAYDPENPMSAYNFRQQ
QNQQLQENKVNLDESMITEVLQRIQQLNLTIREKRDTQNSEQTKDFNADSENQASDKSKE
KQIPYNQISANMKNNNLVIIQNDKIKLIKKDESGQYPVTKSIFYNKPKTPADYIYLTLNI
NDTIFLLERVDWASLIEDNYLGLKEVHSLIELIKISVSQANFQNKYIQIHLQFSLAKKCV
DALGLFSLQQYKIIHELLHTEKLDQILFNFPLQSSLYGSSQFNSDNQSKSCVFKVSQTYD
SVIEQIRIMLSLDEQLFAMTLHQEANSKLAHMFANSLSRIYSSFCRLGSLMNYTKSQYSP
LELSEAGLYNTYDTLSSLRHFEFPFIKIDQLETYKKKVPLWQNISLQIPHSRMMKGQTCL
NVPLYITINNIPFQQHIRARQLNKDNKDQCDFNQIRILRPNRQYTSNYISTVSSDGCVNV
WNTEISLLRVFVSDFKRDFVPPKSLKGLLSTNDLKANLKNVESGLFYDLKFPTKPQNKPR
ESKQIDQKKDFKNQIKDIFCKQVGKNLLAQQGYDQEIASKVIKNIKNNVLEDAVKETEKI
KTQNNQQEEEFLESVQNSQNAPEEEDDQASQENELEWICLQCTFRNTLPEFQNECENCQK
PRRTQTNLELLKEINIKKQKSKELSAIEAMNKLDQLINYNAKVANEKQKLEESQMINPMQ
QMTVSITSITQENKQPLNEEKSYIRPEWVCPQCDQIVQRSQEICDKCGTHVPEEFKCTYQ
EYKSLKQGIEKKMKEEMEKKQAKREEDLKNFCLDENSKVQTGIMINCELSKVCPLIVGVG
MNSTKKDSEVQSMLRIRRFGFDPNYLNNFYKLSNLTGQPNTNQNGSNIQSSKTVINQLDG
SVITEKTMGSIEDSLFRSENNRQVVESIEPLFMSNNRFSNDSSTHQQSIEQQQKIVNQKN
ALFHQDWLELAQHDIVLNEERIIDCVSWCIDSDIQMAHDSIIKNKEMTTSNYNYQMNHTG
EQHQETPENPDKLPYISSSYSQTSSPQMMASLEGRQSFDRSQQNFLLDQESTNINSLRKE
WFRIVLLTETMNQSIKVHIYRLEVDNINPYSSDSIQISILKEFKVSGPGYSTEKSRLFIP
ECSQVAFLITGNQIVNIPLNQEAIQGASIEAKSLKGSPLCTRFVGKNILATVDSQNNLIL
MSQQPQKNQNSFRNSSTSIHSIPSTPIQQSLNEKPQFLTLSLQIQEDLCLHQQYSSKLDQ
FKGNPLFPQSPLKQQSITQNLSHPELNIQDPKQINELKSLLNTYPIGSNVVRTDQGILKS
SIFDSQTKLNVKHTFYQKGFIYFTEPTYLSHLTISFNFQLQQLIQTSTTSNSQNTKINSN
TDLNIAQNILSTSINPSLLFQSNLNLLPNFQFIDNTNQPNTAIQKNNQKLLNIPSLQIFS
NNNNQQNFTSSFNNIQSDYLNLPYNTEILDDPSHYINNLNNKFPRSSFIDEGANNQDQQF
LHLPLTLVYQVGASQSIQQQESLITCPNNESFVTNYAKPSFTFRHLHEKRMIIDFVVVHS
IISSSKGAYPIGSGLIFVADNISFFDMIDSFHGMNMAGYNQWKLQRKQIDTPLQQWEPIG
CFEFVNNKEVIKVEMDVKRAAKFVHLLPTNFRSQPEDFTGYFKSGILDIQYFGVQGQVLE
EDTSQDDNYVFYEELSNQNYICEACRNEKDRFPKSQEFTQEPQFLQFQQQQKAEFIFNQQ
ISTDELIDSGVIKIEVQIEKDNSWHELNSNNILILKRLNINNPLDNYPISKLPNSLPLLN
QILESKYNLFPSKSLDLRISPKIFFENKIIALRIQLNQNASNLIYSNFFQNKNVVDSFVQ
YALKDFSVECFQSKDDCLINLKKEQIQEYRHTLLDPEKYEYLNKNIIKYVLLQAHKANSA
ESENHKERKLQTLKLLTKLMKVENRLVQLFYKDLDLKTFIELMIFEFNDGCYESSSFSNQ
YTENLKEVFEFLYQFRSVFTFASDLEQVLIDQISSNIFDSKKYQENLSNSKNYDQKDQKQ
VNQRGLKRFFCLLKWCSNILGQQIFDKLLELLHKVTIQFKTQKNINYYLLRYEHNIADFL
FEKQLFTNKFVSQYSQQLQQSQNKNFNNLNSNQQIQGGSLMTNSIQQGLKNEQGNKNFSN
LLNSDLVIKEHSLETSSIQYPQISVQNALNFNEAASASTSLKLNKALVKDKEKKSNGQKI
NEFLTDQIFVGDKQDNQEIFLTSKQKQRLLKSRIHADVDGSTNKIYTIDLMKYHDIKNIL
LTFDKVSRSCAVRMKVQIYRVHQNYYYENGFEKVLIYSNDYQTCVTNQLAVLSHQHEYQN
QYFNPNSQNLNSLGFSYFEGVTTRYLIVQLTFAFVPYASQYTDIEQSARIEVIPEVFGVI
SQDQNINTPLKYFQQLFEGNRIEELKIIKTIQLNPGLNQFKKVQISFTSFYLDSLNYYEQ
QIEQVLQQNSKKIQNLLVSTTQGNVLGTNLTSSVYFNQSQNAGHLFSPKSNKNSLNLSVA
KNNLSVSQQTQNIPNIQQNSQNLTTSKASQKSLKKTNESQELEEKLKYVSYNFFFTSSSV
SKKKKENKLNSAQSNVEQNKPNSDQIKTNQEQTKLNIEQNKTNTNELTKSINISQTNFQQ
HQNVSQPPMLLSSASQMLYPNSGQMNLQDDDLDNDDDLFNMITQSKKEDIERLEKDEVKE
EIGEDDEEQYGILSSQLNNDMQYDMRQDLINQVQELQDELSIRLIKYHEKEKHHKQTVEM
SSSKVQNDHSQSFPSFKNFSFQHSQYNEERITKLKQEQLQIQQLCNQIRQIQLQLLNLEE
QNQGKSTSVQKNKQKQQTDESNQSLDFLACLTYELCSFLKYDEKLIFRLIQKDQKLITEN
QISNTGLNSVKEEDIQYQNGSPKSSSDERKFQDINWEDDAQEEEEKKQNDQKGLQEGGSF
LVKLSLELFDTFIVNESGLLHNEVKAFFQDILLKSINRLDINKILNQIIEKYLIEPFLQK
NLNSYQQHQSIEATINQLKESVLKNNGQFYSASKIINIVNIFNIVDVNTFFLKLKEKQEQ
TELFLNTQDNQQQNGQVSNPSSQNSQKLQELLLYVWSLTSMLKNEYLKIQLRQIFTQQRN
QQFIQQQQQLFEKQLNEDDLNNQENCQGLYICQNLIRFLLQNSSTIAEKDISSLLTHLFD
LMLMIINCVPLSHISKITQLFFSSNITGLTSATKKQEEKQQGIPLLYSIFFKAMSLNHQP
LLQVLEVFITNLVFPKQLENYSELTICSTQPLAKIQLTEELDKYLETQLQILYHLQQMIG
YLLDYPKNCNSSSPYTQVILSSNAKTRLPLSNWIGHLKFLLQILQNSSKSIVLIHKKTQN
STSKKMQEIQRRKTSISSRKSSLASRKNSCGLDQLDHAPTNLTRSKTTPPNNDLQVFNLQ
SNSNQITLEEYIDHCILDKQLLIQTNIALKLVDLLNPKEEQPEQKKIDEVEEEEFEDDIN
DASQEAIDDKEIKNFYKFQNNIQIWGLIMSTASLLKGQILQESNIYTNLLNQYLKSSDEV
KSIYLKSFLNLTKTILQSGYQIKEFCNDLFVIIFKIIFKKNSSHSKLLGYKKDSANSSQF
SESPEQQRNQILNSKSFIEDQNLYYLVNGLLEILLTKETPAPEEFYQAQHQQKEWKNSFC
KLNARGAARLFIGISKFLVRQLNFGGVEGVHMADEMIISKLQVADYILKILLSAESSFQH
LAIVEALSNWNLVEFLKSSYSRCIIWYFFNKPDEVMKGVSPATILIKSIGNQVLKLFTIA
GEKQNITEICIELLFKHSMIFSKALFSNIPKLNEQQSEFGTSQNISSASHMHSHFSNLLP
FSNQLQNQDISVFNLTNMSITNYNALILATRQSKIFQELLNLWITNDSLAQFLTFKINGF
SHLLDIIGLNSFNQVQSLNDQSKTYQYSSLNEINTTNMPMFGNEDSLFVNQNVLNYISII
QSGSDKQLPTQSSLNNQTIYNPWNQYTMQNISSAHKIPPPSLQFGSSSFALIKNPQLAPF
NNGDKKNLFFHDSAQNLNSQNNSHIQIQQNVALAPFMTQGSGASSFEPAGLLFGNSEIHE
NQKSSFIKYQIQHPSYVNNFNATNNNSLNSHNMSNSNNSNQSFPQMMNNPLFSKLPSNLN
FQSTINNGIKSNHSIVSPGVISNTIPQLPPIPPMQYNNYSNNTITPQNIIQNNQNPFINQ
QIYTSSSSSGNNTINLNPFTQNFYQQYPTIPLSDLNDSDIISLANNLQQDYLQQKSKIYE
MNNPLRTNVTNQTVDPLQQLVEIECCNQIQLIPLIGQNFQIAQGIQDWSYSKKGCKNKIA
IHLLSGSQHQELQVLLKLNKTVEIKKFKIGFNCQSVEQSDSQKIIGIPSGVIVEGGLSES
KLVPLGFLHQINDDKYLNFGVKVFAKNFARVNDETGNIDKCIKSLSSPKVSYIKLRIIRP
IITLIEDSSSFVNKQFGSIAISINFLSIIGYQVDHIASNLSQFIYKIQTDSAIQILGKLC
AEGMGFDKTIQSISNDKQIIQKIKDGFECVESLISQYEQPISQLLICIALNNDEFADWIF
DYLLDSSRNKTPLAKLLTEIIISQKQQYNDKVLSNKALPRVEKLYEYIVKQIKQYLESNP
TDKDIEVDADGILSLSSIFPFVDALIAALRISYPHPKMNQNEKEKYQVKEIMKLRVNIEI
IQSLISIYLKCVKQKAEGFSKLSIKLLVSLLYLPLPFYCDNQENLIKESLNLIWDSLIQK
KQYQLTELMVVLAYGGDQCQRWFLEDNQNHFKQLIHNINQEMSLASSNEKNTQNNILQSQ
NLNNQTITNSKKAKSLFSILCAISNSQEIQNLLIQTSPGNNSSNNTNQIPEYIKIYSLMK
LKKSENIFFSSTSSIGSSSYRLLQNWVDQEFLQLFVEFLKKISYSKQEVIDSIVHGLIED
IKELEHKKDHLFVNDLLLPILQSIQTVPMCFHAFDSLQRKWLINPIKVLNHPYYLAKFQQ
SSKSKAQKNIDKFNTKLFSQEQKQVFMKTLKKFTLDTGLYKKIKKYEWIKEATQEVDSQS
SLINKLENKILNNPPYIIVIEGVNSGQKCLCGVFSSQAIQKSSLESTFNISNGDDCFIFY
YSENYQIHFRVEGNDFGQLDVSPETSFLTFKYRELDRIYLSFSEGSSSYVDINMFDMKPI
ENSQNIPHDIPNDFSFIKAEYWVLRPQTIELSEDRKHPFKMENMYDIQNTQHHLFNSEYY
KPDNAYNFYRSPAVYHFPEDLTLQQVITQLNVPGLQVSKEVLQQFSFNLRQSAKFFSCKD
NINLRSLYQEIDKNSNGIIDLEYNVDQFFQQAPKIQQLSQPQQIEQQNLDNQKQNKIIDA
FIDQKGFKTIISVIKEQLNSWNSKTRAKKWLVYVQELNTFSVLPNFIYEFMKKKEGVNIL
FQLLSGSLDSSNELKSEKQEDNKMHQMKQPLLDGLSEDYPITKAFKKSYYSQEKNKEDFE
KNKQFEEQERNAVQNIYEILSQLFQQDKDNHKIKSIAIENNILQIIFDRISSVSKEKPRK
FIENTPAQDKKLSDDDNKLKLDSPILIMGVQRTGQGEKDEKSRSNQNVDKKKKGTGYASD
NTGQNQKWNTSEYVEINKSRNQLLLSLMKILQSFFNFESWSIPNKVIHSICESSLLPLLE
SAFRSGSLLEICKESQLMIQYLQLIEVMSQNKSLIKCLMKLDQRYQPTQTESISELLSKL
RTTAEIFLNCIKPVQIQVPESTVKSSISIQKDMLAQSNANLLKQWGADKDILNEEKKFQK
ILNDQEEGNLQSQQVATSIIQVHEKLDQAIQEFNEHIQESTSQNFSNLDQEQDEGQEQIQ
KVQRVLELPLNVKYKILLEKLRFGYFSMNNNNLNTYNHHYQQQIMQNQNPSQVKMVRLAQ
EIADMANSLPIDHTSSIFVRCDSKRVDVMKCIIMGSSGTPYAHGAFLYDIFFEDSYPNTS
PRVNLQTTGNNKVRFNPNLYNCGKVCLSLLGTWKGQASENWDPKISTLLQVLVSLSAIIM
NEDIYFNEPGYEGHSGTEDGDRKNEAYSNIVRFSNIKYAMIQTIRNPPEGFEDVIKRHFY
LKKDEILKECEGWIERSTKKQASYVGLVSDHNPQICQEFKQPNKYTEQLKLAVQDLRQEL
EKLTPPSSIETQEELAKKKARSQKQHEKKQNLNKQNNQKQNIPTAVLHNALDDLQQQEIP
IKNNKINKQEEIDVESEEVKDRWSRYICAMGIDAVAKQSKCNIFLSGLGPLGVEIAKNIV
LSGVKKMTLHDNHIVNYRDLSGQFFLKKECVGKNRAEACLQDIQLLNHYVRVDTNVNQVN
ADTSTLLEKLYLQDYHVVIITECYSLDILTAINTFCRSRSIKFIYTQVQGPFGLLFNDFG
DNFEVIDKNGEDPVELVIQNIQQVQAGEKSNKLKVTLLPGFKHPYEDKDKVIIKEVQGMQ
EVNNQSKSINDSIFEIETINSNSFYILTNNLYSPYQGSGVVKNIKTPIYLSFQSLKQCIQ
ANNMEYFDANMASHDFEKMDTIPYLHIAFQALQEFIQINFRYPHPWNQKDAQTMLEISKS
LYGAFDIPQKEDEKNKLKFEEYINKFSFTVSGTFHPLCAFMGGYVSQEVIKAITNKFVPT
KQLFLTDCIEVLPDINWSDKKSSEEQISRLQSQFENEKEFEVQNELQLKIVIGSETSEKL
SHCKLFMIGSGAIGCELLKNFAMINLCTGEEIPERNLRKGQLTLTDPDHIETSNLNRQFL
FREEHLRKPKSSTAAQAAIKMNNKLKNHIVACLDKVCEATKNIFSEEFFEDQDIVANALD
NVEARRYVDKRCVSSKTPLLESGTLGPKGHVQVIIPYKTESYGSQQDPQEEGGDIPHCTL
KMFPEETLHCIEWARDKFGKIITLKPKIVQKTLDEIENIKEGKISCEIINLRKTLKALKN
RPLSFEDCIEYAVQKFYKLYRNNIRQLLYTYPLNHKNKDGSDFWKLPKRAPFEISQLDEQ
NPLHRDFIVALSVMRAKSFNIPYPQSFRQQSEKIQIMQIAMNCKIADFQPSDEKSTEIKQ
EVNQENDKTQEQASINQQEISQIQTETNQNNINELKQNQIISNDENPNYLIEQILLQKLN
LQQQTFMHSEEFEKDNDSNGHIDAIYAMANLRSINYSLTPMDWINVKLKAGKIVPALATT
TAAIAGLQTIELVKTLKKVDICKMKNAFLNLAVPSLQLTEPAGPPSFQITKNLKASIWDR
WDVWLNKQDSLKKLFNYFEEKMQLSPFSILIGTDLIYSFTMNTEDKQFIQDSTFSEVLNN
NNQLILSEAKYIDLNILFTELNGNQILLNTPSVRLFFGVKEEKQQ


>TTHERM_00028560(gene)
ATGAAAACAAGTTATAGTGAAAAGGTTATTGCTGATATATCAAAATGCTCTGATTTCACA
TATGATAGCAAAAATCAAGAATTAATATTTATAGATTCTTGTCTTTCATTAAAATCTATA
AGAGTTATTGAGAATAGTGAGTCATAAATAATAAATTGGAAAGATGTAAATATTTAAATT
TTGCATAATGGTTAATAAGATTTATCTCCTCAGCTTTAAAGTTCTTAAAACGTTAATTTT
TTATCATCTTAGAAAGCAACTTAATTTGATAATAATGAAAAATAATAACAATCTATAACA
AGCTAACCTGCACTAATTGAAAACCAAGGCATAGAATTAGACATTTAAGAATAAGCTAAT
TAATTAAATTATTCATCTGCACGCATGATACCATATATTAGCTAATAGACAGCAAACCTT
CCTGCTAACTAATAAAATAAATTACTTTTTTCTAATTCAGGTCTTACAGTAACATGCATG
GATACATCACCTTAAATAGCAATTTCAACAATAGGATTTTGTGAAGGAGAACATTTTTGG
GAGTTTTATTGTCCTATTTACTGTTAAAAAATAGAAATGGGTATAATTGCTCCTTCCATA
TAATAGTTTCATTTAATCGAGTTCCATACAACAACTCCAAGACAAGTTACTTTTAGATTG
AATTTCAATACATGCAAGCTTTCTACTTACTTAAATGGCAATTTAAACAATCAAAAATCT
TAAATTCTCTCCTTCTTAAAACCCTTAAGCGACTAAAATGCAGTATCATCTGAATCAAGT
ATTTTTTTAGCAAAATATTACCATTAAATTTAAATATCATTCATTGAAATTTGTTTTTGC
ACTTAGTGCTTCGAATGAATTTGCTTGCTTTAATGTAAAACTAAAGCATATTACATAAAT
AAGTCAAGTCTAACTGAAAATAAACAAGATAGTTATTTTTTACAAAAAATAATTTTATTA
AAAAATAATCAAAATGAATTTTTATTATTTATTTGATGTATGAAAAATAAAGTATTAATC
ATATTAATTTAAATTTTAATAGATTCCTAATAGATTATGTGGTTTCCTGCTATTAAGATG
AAAGAGGTAGGAGTGAGTGTTATATTTAATCCCTTCGCATATGATCCAGAAAATCCTATG
TCTGCATATGTAATAAATACAATAATCTGCTACTTTAATTTATTTAAAATCATAAAAAGT
AAATTTTAAATTTATTTAATCTTAATAGAATTTCAGGCAACAGTAGAACTAACAATTATA
GGAAAATAAAGTTAATTTAGATGAAAGCATGATAACAGAGGTTTTGTAGAGAATATAATA
GCTTAATCTTACAATTAGAGAAAAGCGTGATACATAAAATAGCGAATAGACTAAAGATTT
CAATGCAGATAGCGAAAACCAAGCATCTGATAAAAGTAAAGAAAAATAGATACCATATAA
CCAAATTAGCGCTAACATGAAAAATAATAATCTAGTTATTATTTAAAATGACAAAATCAA
ACTCATTAAAAAGGATGAGTCTGGATAATACCCTGTTACTAAATCTATATTTTATAATAA
ACCAAAAACTCCTGCAGATTACATTTATTTAACCTTAAATATTAACGACACTATCTTCTT
GCTAGAAAGAGTAGATTGGGCTAGTTTAATAGAAGATAATTATTTAGGCTTGAAAGAAGT
TCATTCATTAATTGAGCTGATTAAAATATCTGTTTCATAAGCTAATTTTTAAAATAAGTA
CATTTAAATACACTTGTAATTTTCATTAGCCAAGAAATGTGTAGATGCTTTAGGATTATT
CTCTCTTCAATAATATAAAATTATTCATGAACTGCTCCATACTGAAAAGTTAGATCAAAT
TCTATTTAATTTCCCACTATAATCATCTTTGTATGGATCCTCTTAATTTAATTCTGATAA
CTAGGTAAGTTTTACAACTAAAAGAGAAGAATATATGTTATTTAAATTTTTTTTTATAGA
GTAAATCTTGTGTATTTAAGGTGTCACAAACTTATGATAGCGTTATTGAATAAATTAGAA
TAATGCTGAGTCTTGATGAATAATTGTTTGCTATGACTCTTCATCAGGAGGCTAACTCCA
AGCTTGCTCATATGTTTGCTAATAGCGTAAAATAACAAACTTTCAGTTTTAATAATATTT
AAATTTACAATATAAAAAAAGCTTTCAAGAATATATAGCAGTTTTTGTAGACTTGGCTCT
TTAATGAATTACACAAAATCTTAATATTCACCACTTGAATTGTCAGAAGCAGGATTGTAT
AACACATATGATACTTTATCAAGTTTAAGACACTTTGAATTTCCTTTTATTAAAATTGAT
TAGTTAGAAACATATAAAAAGAAAGTACCTCTCTGGCAAAATATTTCATTATAAATTCCT
CATAGCAGGTACAATTTAAAATTTATATTAAATATTATGTAGAAAATTTTAATTAATCTA
AAATTAGAATGATGAAAGGACAAACATGCTTAAATGTTCCACTCTATATCACAATTAATA
ATATTCCTTTTCAATAGCATATAAGAGCTAGATAATTGAATAAAGATAATAAGGATTAAT
GTGATTTTAATTAAATCAGAATACTAAGACCTAATAGATAATATACATCAAATTATATTT
CCACTGTAAGTTCTGATGGATGTGTCAATGTTTGGAATACTGAAATATCTTTACTAAGGG
TATTTGTTAGTGATTTTAAGAGAGATTTTGTTCCACCCAAATCTCTAAAAGGACTGCTTA
GCACCAACGATCTCAAGGCAAATCTAAAAAATGTGGAAAGCGGACTTTTTTATGATTTAA
AATTCCCTACTAAACCTCAAAATAAGCCAAGAGAGTCTAAATAGATCGATTAGAAAAAAG
ATTTTAAGAATTAAATAAAGGATATATTTTGTAAGCAAGTAGGTAAAAACCTTTTAGCAT
AAGTAAATATTTTATTTATTTAATATTGATAATTATGTTTATTTTATTTATTAGTAGGGA
TACGACTAAGAAATAGCTTCTAAAGTTATCAAAAATATTAAAAACAATGTGCTTGAAGAT
GCTGTTAAAGAAACAGAGAAAATAAAAACATAAAATAATTAATAAGAAGAAGAATTTTTA
GAGTCTGTTCAAAACTCATAAAATGCTCCAGAAGAAGAAGATGATTAAGCATCTTAAGAA
AATGAATTGGAATGGATTTGTTTGCAATGCACTTTTAGAAATACTCTCCCTGAGTTCTAA
AATGAATGCGAAAATTGTTAGAAACCCAGAAGAACACAAACAAATTTAGAATTGCTAAAA
GAAATAAATATTAAAAAGTAAAAATCGAAAGAGCTTTCTGCAATTGAAGCCATGAATAAG
CTAGACTAGTTGATAAATTATAATGCGAAAGTTGCTAATGAAAAGCAAAAATTAGAGGAA
AGTTAAATGATAAATCCTATGCAGCAGATGACTGTATCAATTACTTCAATAACATAAGAA
AATAAATAGCCTTTAAATGAGGAGAAATCATATATCAGACCAGAGTGGGTTTGTCCTCAG
TGTGATTAAATCGTGCAAAGATCGTAAGAAATATGTGACAAATGTGGCACACATGTACCA
GAAGAATTTAAATGCACCTATCAAGAATATAAATCCCTCAAATAAGGAATTGAAAAAAAA
ATGAAGGTATCTTATAAAATCTTAATTAATTAATTCACTTTCCAGATAGAAATCAAACAA
AAATTTTTTATTAATTTAATTGATTTTTTACATAAATATCTTTATGATTATTTAATTAAA
GGGAAAATACAATAAATAAATAGTTTTACTTTTAAATTAAAGTTTTATGAAAATAAATAA
AATATATTTTATTAATGTAAGATTTATAAAAGAAGAAATATCTTATTGAAATTTTATTAT
CAGAATAAATATTTATTTATTTATTTAAAAAAAAATAATAGGAAGAAATGGAAAAGAAGT
AGGCTAAGAGAGAAGAAGATTTAAAAAACTTTTGTTTAGATGAAAATAGCAAAGTTTAAA
CAGGAATTATGATAAACTGTGAGCTAAGTAAAGTTTGCCCATTAATAGTAGGTGTGGGTA
TGAATAGCACTAAAAAAGATAGTGAGGTGCAGTCGATGTTGAGGATCAGAAGATTTGGAT
TCGATCCAAATTATTTAAATAACTTTTACAAGCTAAGTAATCTTACAGGCTAACCTAACA
CAAATTAGAATGGAAGTAATATATAATCTTCTAAAACAGTTATAAATTAACTAGATGGAT
CTGTTATTACAGAAAAAACAATGGGTAGTATAGAAGATTCACTATTTAGAAGTGAAAATA
ATAGGTAGGTAGTAGAGTCGATAGAACCACTTTTCATGAGCAATAACAGATTTTCAAATG
ACTCATCCACTCACCAGTAATCAATAGAGCAATAACAGAAAATAGTAAACCAAAAGAATG
CTCTTTTCCATTAAGATTGGCTGGAATTAGCATAGCATGATATAGTTCTGAATGAAGAAA
GAATCATAGATTGTGTTTCCTGGTGCATAGATTCAGATATTTAAATGGCTCATGATAGCA
TAATTAAGAATAAGGAAATGACCACCTCAAATTATAATTATTAAATGAATCACACTGGAG
AACAACATCAAGAAACTCCAGAAAATCCTGATAAATTACCTTACATTTCTTCATCATATT
CACAAACATCGTCACCTCAAATGATGGCTAGCTTAGAAGGCAGATAAAGCTTTGATAGAT
CATAATAAAATTTCTTATTAGATTAAGAAAGCACTAATATCAACAGCCTTAGAAAAGAAT
GGTTTAGAATAGTGCTTCTGACAGAAACTATGAACTAATCTATTAAAGTACATATTTATC
GACTTGAAGTAGATAATATTAACCCTTACAGCAGCGATTCGATATAAATATCCATTCTAA
AAGAATTCAAGGTAAGTGGTCCAGGATACTCAACTGAAAAGTCTCGCCTATTTATACCAG
AATGTAGTTAAGTTGCTTTCCTCATAACTGGTAATTAGATAGTTAACATACCACTCAATC
AAGAGGCCATCTAAGGAGCATCAATAGAAGCAAAATCGTTAAAAGGATCTCCTCTTTGCA
CCAGATTTGTAGGGAAAAATATACTTGCTACAGTAGATTCTCAAAATAATTTAATCTTAA
TGAGTTAATAACCACAAAAGAATTAAAATAGTTTTAGAAATTCTTCTACTTCCATCCATA
GTATTCCATCAACTCCAATTTAATAGTCATTAAATGAAAAACCTTAATTTTTAACTCTTT
CATTATAAATATAAGAAGATTTATGCTTGCATTAATAATACTCATCCAAACTAGATTAGT
TTAAAGGAAATCCTTTGTTTCCATAATCTCCTCTAAAATAATAAAGTATCACTTAAAATT
TATCTCATCCTGAATTAAATATTTAAGACCCAAAGTAAATAAATGAGCTTAAATCTTTAC
TGAATACATATCCTATTGGTTCGAATGTAGTACGAACAGACTAAGGAATATTAAAGAGCA
GTATTTTCGATTCTTAGACTAAATTAAACGTTAAACATACGTTTTATTAGAAAGGATTTA
TTTATTTCACAGAGCCAACATATCTCAGCCATCTAACTATTTCTTTTAATTTTTAATTAC
AATAATTAATTTAAACAAGCACAACTTCAAACAGCTAGAATACTAAAATTAACTCTAATA
CAGACCTAAATATCGCATAAAATATTCTTAGTACTTCTATCAATCCTTCATTATTATTTT
AATCTAATCTTAATCTCCTACCGAATTTTTAATTTATAGATAACACAAACCAACCAAACA
CAGCAATTCAAAAAAATAATCAAAAATTACTTAATATCCCAAGTTTACAAATTTTTTCAA
ATAATAACAATTAATAAAATTTCACAAGTAGTTTTAATAATATTTAATCTGATTATCTAA
ATTTGCCTTACAACACTGAAATTTTAGATGATCCTTCTCATTATATTAATAATTTAAATA
ATAAATTTCCTAGAAGTTCATTTATTGATGAAGGTGCTAATAATTAAGATTAATAATTTC
TTCATCTTCCTTTAACTTTAGTCTACCAAGTAGGAGCATCCTAATCCATTTAATAACAAG
TAATTTAAAATTTCTTTTTATATTTTTTATTAATCTTTTATTTTAAAGGAATCACTTATC
ACCTGCCCTAATAATGAAAGTTTTGTGACTAATTATGCCAAACCCTCTTTTACTTTTAGA
CATTTACATGAAAAGAGAATGATAATCGATTTTGTAGTAGTTCACTCTATAATTTCTTCT
AGCAAAGGAGCCTATCCTATTGGCAGTGGATTAATTTTCGTTGCAGACAATATAAGTTTT
TTTGATATGATAGATTCATTTCATGGAATGAACATGGCAGGTTATAATTAATGGAAATTA
TAAAGAAAACAAATAGATACTCCTCTACAGTAATGGGAACCTATTGGATGCTTTGAATTT
GTTAACAATGTATATAACATATCAGTTTTGTTTTTATGATATTATAAGATTTAATTATTA
TAAAAATAGAAAGAAGTAATCAAAGTGGAAATGGATGTGAAAAGAGCTGCAAAATTTGTG
CATTTATTACCAACTAATTTTAGAAGTTAACCTGAAGATTTCACAGGCTATTTTAAGTCA
GGAATATTAGATATATAATATTTTGGTGTTTAGGGTTAAGTATTAGAGGAAGACACCTCA
TAAGACGATAATTATGTATTTTATGAAGAACTTAGTAATCAAAATTATATATGCGAAGCA
TGTAGGAACGAAAAGGATAGATTTCCAAAAAGCTAAGAATTCACTTAAGAACCTCAGTTT
TTGCAATTCTAGCAACAATAAAAAGCAGAATTTATTTTTAATTAGCAAATTTCGACTGAT
GAATTGATTGATTCAGGAGTTATCAAGATTGAAGTACAAATTGAAAAAGATAACTCTTGG
CATGAGCTAAACTCAAATAACATTCTTATCCTAAAAAGGTTAAACATTAATAATCCCTTA
GATAATTATCCTATTTCAAAGCTTCCTAATTCTTTACCTTTGTTAAATCAAATATTAGAG
TCTAAATATAATTTATTTCCCAGCAAAAGTCTAGATCTTAGAATTTCTCCAAAGATATTT
TTTGAAAACAAAATTATAGCATTAAGAATTTAGTTAAATTAAAATGCATCAAATTTGATT
TATTCAAATTTCTTTTAAAATAAGAATGTTGTTGATAGCTTTGTGCAATATGCTTTAAAA
GATTTTTCTGTTGAGTGTTTTTAGAGCAAAGATGACTGCTTAATTAATTTAAAGAAAGAA
TAAATTCAAGAATATCGTCACACTCTCTTAGATCCTGAAAAATATGAATACTTGAATAAA
AATATTATCAAATATGTTCTACTCTAAGCTCATAAAGCTAATAGCGCTGAAAGTGAAAAT
CATAAAGAAAGAAAGCTACAAACTTTAAAGCTACTCACTAAATTAATGAAAGTCGAAAAT
AGACTTGTGTAACTATTTTATAAAGATTTAGACTTAAAAACATTTATTGAGCTTATGATT
TTTGAATTTAATGATGGTTGCTATGAAAGTTCTAGCTTCAGTAACTAATATACAGAAAAC
TTGAAGGAAGTATTTGAGTTTTTATATTAATTTAGAAGTGTTTTTACTTTTGCTTCAGAT
TTAGAGTAAGTTTTGATAGATTAAATATCTTCTAATATTTTTGATAGCAAAAAATACTAG
GAAAACCTATCAAATAGTAAAAATTATGATTAAAAAGATCAGAAATAAGTTAATTAGAGA
GGATTAAAGCGTTTCTTTTGTTTACTAAAGTGGTGTTCTAATATTTTAGGTTAATAAATA
TTCGATAAGTTGCTAGAGCTTTTACATAAAGTAACAATTTAATTTAAAACTCAGAAGAAT
ATCAATTATTATTTACTTCGCTATGAGCATAATATTGCAGATTTTCTTTTTGAAAAACAA
TTATTTACAAATAAGTTTGTCTCGTAATACTCATAATAACTTTAATAGTCTTAGAATAAA
AATTTCAATAATCTAAATAGCAATTAATAAATTTAAGGAGGATCATTGATGACCAATTCT
ATATAACAAGGCTTAAAAAACGAATAAGGGAATAAAAATTTTTCAAATTTGTTAAATAGT
GATTTGGTAATTAAAGAACATTCTTTGGAAACTTCCTCTATTTAATATCCATAAATATCA
GTCTAAAATGCCCTCAATTTCAATGAAGCAGCTTCAGCATCTACTTCTCTAAAATTAAAT
AAGGCACTTGTCAAAGATAAAGAAAAGAAATCGAATGGATAAAAAATCAACGAATTTTTG
ACTGATTAAATATTTGTTGGAGATAAACAAGATAATCAAGAAATATTTTTAACTTCAAAA
TAAAAATAACGTTTATTGAAAAGTCGTATTCACGCTGATGTGGATGGCAGCACTAATAAA
ATATATACTATTGATTTAATGAAGTATCATGACATAAAAAACATTCTTTTGACATTTGAC
AAAGTTTCGAGATCTTGTGCTGTAAGGATGAAAGTTTAAATTTACAGAGTTCATTAAAAT
TATTATTATGAAAATGGATTTGAAAAAGTTCTCATTTATTCTAATGATTATTAAACTTGT
GTCACTAATTAATTAGCCGTGTTAAGTCATCAGCATGAATATCAAAATCAATATTTTAAC
CCTAATTCTTAAAATTTGAACTCTTTAGGGTTTAGCTATTTCGAAGGAGTTACTACAAGA
TATTTAATAGTTTAGCTTACTTTTGCATTCGTCCCATATGCATCCCAATATACTGATATA
GAATAATCGGCAAGGATTGAAGTAATACCTGAAGTTTTTGGTGTTATTTCGTAAGATTAG
AATATCAATACTCCTTTAAAATATTTCTAATAGCTTTTTGAAGGTAATAGGATAGAAGAA
TTAAAAATAATTAAAACAATATAATTAAACCCAGGTTTAAATCAATTTAAAAAAGTTTAA
ATATCATTCACAAGCTTTTATTTAGATAGCTTGAATTATTATGAGCAGTAAATTGAACAA
GTTTTACAATAGAACAGCAAGAAAATACAAAATCTATTAGTATCAACTACTTAAGGGAAT
GTACTTGGTACTAATTTAACAAGTAGTGTTTATTTCAACTAATCATAAAATGCAGGTCAC
TTATTTAGTCCTAAATCAAACAAAAATAGTCTTAATTTAAGTGTCGCCAAAAATAACTTA
AGCGTTTCATAATAAACATAAAACATTCCTAACATTTAACAAAACTCATAAAATCTTACT
ACTTCTAAAGCTAGTTAAAAATCTTTAAAAAAAACAAATGAAAGCTAAGAACTTGAGGAA
AAGCTTAAATATGTTAGTTACAATTTTTTTTTCACATCTTCATCTGTATCCAAAAAGAAA
AAAGAAAATAAATTGAATAGTGCTTAATCAAATGTGGAACAAAACAAACCTAATTCGGAT
TAAATTAAAACAAATTAAGAATAAACAAAACTTAATATTGAATAGAATAAGACAAACACT
AATGAGTTAACTAAATCGATTAATATTTCATAGACAAATTTCTAACAGCATTAAAATGTG
TCCTAACCACCAATGTTACTTTCATCTGCTTCTTAAATGCTATATCCAAACAGTGGATAA
ATGAACTTACAAGATGATGATTTGGACAATGATGATGACTTATTTAACATGATAACATAA
AGTAAAAAGGAGGACATAGAAAGATTAGAAAAAGATGAAGTAAAAGAAGAAATAGGAGAG
GATGATGAGGAATAATATGGAATACTTTCATCATAACTGAATAATGATATGCAATATGAC
ATGAGATAAGATTTAATTAATTAAGTCCAAGAATTGTAAGATGAATTATCAATAAGGCTT
ATTAAATACCATGAAAAAGAGAAGCATCATAAATAAACTGTTGAAATGAGTAGCTCTAAA
GTATAGAATGATCATAGTTAGAGTTTTCCCTCTTTTAAAAACTTTTCATTTTAACATTCA
TAATATAATGAAGAAAGGATTACGAAATTAAAATAAGAATAATTATAAATATAGCAGCTA
TGTAATTAAATTAGATAAATATAACTTTAATTGCTTAATTTAGAAGAATAAAATTAAGGT
AAAAGTACTTCAGTATAAAAAAATAAGCAAAAACAATAGACAGATGAATCTAATTAATCT
CTAGATTTTCTTGCATGTCTTACATATGAGCTTTGTTCTTTCCTTAAATATGATGAAAAG
CTTATATTCAGGCTTATTCAAAAAGACTAAAAACTAATCACTGAAAATCAAATTTCAAAT
ACAGGATTAAACTCAGTAAAAGAAGAAGATATTTAATATTAGAATGGCTCTCCAAAAAGC
AGCAGTGATGAAAGAAAATTCTAAGATATAAATTGGGAAGATGATGCACAAGAGGAAGAA
GAAAAAAAGCAGAACGATTAAAAAGGCTTGTAAGAGGGAGGGTCATTCCTTGTTAAGCTA
AGCTTAGAATTATTTGATACCTTCATTGTGAATGAAAGTGGTTTGCTTCATAATGAAGTT
AAAGCTTTCTTTTAAGATATATTATTAAAATCAATTAACAGGCTAGATATTAATAAAATC
CTCAACTAAATAATAGAAAAATATTTAATTGAGCCATTCTTACAGAAGAATTTAAATAGT
TATTAGTAGCACTAATCCATAGAGGCAACCATAAATTAATTAAAAGAAAGCGTCTTAAAA
AATAATGGTCAGTTTTATTCTGCTTCAAAAATAATTAATATAGTTAACATTTTCAACATT
GTAGATGTGAATACATTTTTCTTAAAGCTGAAGGAAAAGCAAGAACAAACTGAATTATTT
TTGAATACCTAAGACAATTAACAGTAAAATGGCTAAGTTTCAAACCCTAGCTCACAGAAT
TCCTAGAAACTTCAAGAGCTGCTGTTATATGTATGGAGCTTAACTTCAATGCTTAAAAAT
GAATACCTGAAGATTTAATTAAGATAGATATTTACCTAGCAAAGAAATTAGTAGTTTATT
TAATAGTAATAATAATTATTTGAAAAGTAGTTGAACGAAGACGACCTCAACAATTAAGAG
AACTGTCAAGGATTGTACATTTGCTAAAATCTCATTAGATTTTTGTTATAAAATTCTAGC
ACTATAGCTGAAAAAGACATATCTTCTTTGCTTACTCATTTGTTTGATTTAATGCTTATG
ATTATCAATTGTGTCCCACTTTCACACATTTCTAAAATAACATAGCTATTTTTTTCATCT
AATATCACAGGATTAACAAGCGCAACTAAAAAATAAGAAGAAAAGTAGTAAGGAATACCT
CTTCTTTATAGTATTTTCTTCAAAGCAATGTCTTTAAACCATTAACCTTTGCTGCAGGTT
TTAGAAGTATTTATAACAAATCTAGTTTTTCCTAAGTAATTGGAGAACTACTCAGAACTA
ACAATATGTTCAACTCAGGTAATTATTTATTTATTATCAATAAAATTGAATTAATCTTAT
AAATTACTTAAATTCATATTAGCCTTTAGCGAAAATATAACTAACAGAGGAACTTGATAA
ATATTTAGAGACTTAGTTGTAAATACTTTATCACTTATAGTAAATGATAGGATATTTGCT
AGATTATCCTAAAAACTGTAATAGCTCCAGTCCATACACATAAGTAATATTATCATCAAA
CGCAAAAACACGACTACCTCTTAGCAATTGGATTGGTCATCTGAAATTCCTACTTTAAAT
ACTTTAAAACTCATCAAAGAGTGTAAAATTGTTTGTTTAATCTACTTATATATTTAATTT
TACAAATATTTTTTTAAATAAATATAGATTGTTTTAATACATAAAAAAACTTAAAATTCT
ACATCTAAAAAAATGTAAGAAATATAAAGAAGAAAAACATCAATTTCTTCTAGGAAAAGC
TCTTTAGCTTCAAGAAAAAATAGTTGTGGGTTGGATTAATTAGATCATGCACCTACTAAT
TTAACAAGATCAAAAACTACTCCCCCTAATAATGATTTGCAAGTTTTTAACTTATAATCC
AATAGCAATTAAATAACACTAGAAGAATATATCGATCATTGCATATTAGACAAGTAGTTG
TTAATTTAGACAAATATTGCATTAAAATTAGTTGATCTTTTGAATCCAAAAGAAGAATAG
CCAGAATAAAAAAGTAATTTTGCATTTATAAAATGGCAATTAAATGCTAAATCAAATTAT
GTTTAAATAAAAATAGAAATTGATGAGGTTGAAGAAGAAGAGTTTGAGGATGACATAAAC
GACGCAAGCCAAGAAGCAATTGATGATAAAGAAATAAAAAATTTTTATAAGTTCTAAAAT
AACATATAAATTTGGGGGCTTATCATGAGCACAGCAAGCTTATTAAAAGGATAAATATTA
TAAGAAAGCAACATTTATACTAATTTATTAAATTAATATTTAAAATCATCAGATGAAGTA
AAGTCAATCTATCTTAAAAGTTTTCTTAATTTAACAAAGACTATTCTCTAATCAGGCTAT
CAGATAAAAGAGTTTTGTAATGACCTCTTTGTAATAATTTTTAAGATAATCTTCAAAAAA
AATTCTTCTCATTCCAAACTACTTGGCTACAAAAAAGATTCTGCTAACTCTTCATAATTT
TCAGAATCACCAGAATAACAAAGAAACTAAATTTTAAACAGTAAAAGCTTTATAGAGGAT
TAGAATCTCTATTATCTTGTTAATGGATTACTCGAAATTCTTCTGACTAAAGAAACTCCA
GCACCTGAAGAATTCTATTAAGCTCAACACTAACAAAAAGAGTGGAAAAACTCTTTTTGC
AAATTAAATGCAAGGGGAGCGGCTAGACTATTTATTGGAATAAGCAAATTCCTCGTTAGA
TAATTAAATTTTGGTGGAGTGGAAGGTGTTCATATGGCAGATGAGATGATCATATCTAAA
TTACAAGTTGCAGATTATATATTAAAAATCTTACTCTCAGCTGAATCTTCATTCTAGCAT
CTAGCAATAGTTGAAGCTTTAAGCAATTGGAATTTAGTAGAATTTTTAAAATCTTCATAT
TCAAGATGCATCATTTGGTATTTTTTCAATAAGCCAGATGAAGTGATGAAAGGAGTATCT
CCAGCTACTATTTTAATAAAATCTATAGGAAATCAAGTATTAAAGCTCTTTACTATTGCT
GGTGAAAAGTAAAATATAACAGAGATCTGCATTGAACTTCTTTTTAAACACTCAATGATA
TTTTCTAAAGCATTATTTTCTAATATCCCTAAATTAAATGAATAGTAAAGTGAGTTTGGA
ACAAGCTAAAATATTTCATCTGCTTCTCACATGCATTCTCACTTTTCAAACCTCCTTCCT
TTTTCTAATCAGCTTCAAAATTAGGATATTAGTGTATTCAATCTGACTAATATGTCTATT
ACAAATTATAATGCTCTAATACTTGCTACTAGACAAAGTAAAATATTTTAAGAACTGCTC
AACCTTTGGATTACAAATGATTCACTCGCTTAATTTCTAACCTTCAAAATAAACGGATTC
TCTCATCTTTTAGACATAATAGGTCTTAATTCTTTTAATTAGGTTCAAAGCTTAAACGAT
TAAAGTAAAACTTATTAGTATAGCTCTCTGAATGAAATAAATACAACAAATATGCCTATG
TTTGGAAATGAAGATTCTTTATTTGTAAATTAAAATGTGTTGAATTATATTTCAATAATT
TAATCTGGTTCTGATAAATAATTGCCTACATAGTCTAGTTTGAACAATTAAACGATTTAT
AATCCATGGAATCAATACACAATGTAAAATATTTCATCTGCTCATAAAATCCCTCCTCCT
TCACTTTAATTTGGAAGCTCTTCATTTGCATTAATCAAGTAAAAAATTAATTATCATCTT
TTATTACTTAACTTATTATATTTTTCATAATTAATTAAAAACAAGGAATCCTTAGCTCGC
TCCTTTTAATAACGGAGATAAAAAAAATCTTTTTTTCCATGATAGCGCATAGAATTTGAA
TAGTCAAAATAATTCTCATATTTAAATTCAATAAAATGTAGCATTAGCACCTTTTATGAC
TTAAGGATCTGGTGCAAGTTCTTTTGAACCAGCTGGATTGCTATTTGGTAATAGCGAGAT
ACATGAAAACTAAAAGAGTAGCTTTATTAAATATTAAATACAACATCCATCTTATGTTAA
TAACTTTAATGCAACAAACAATAATTCTTTGAACTCCCATAACATGAGCAATAGCAACAA
CTCAAATTAATCATTCCCATAAATGATGAATAATCCTCTTTTTAGTAAACTTCCTTCTAA
CTTGAATTTTTAAAGTACAATAAATAATGGAATTAAGAGCAATCACTCTATAGTATCTCC
TGGGGTTATTTCAAATACTATCCCTTAGCTACCACCCATTCCTCCTATGTAATACAATAA
CTATAGTAATAATACTATAACTCCATAAAATATAATTTAAAATAACTAAAATCCCTTCAT
CAATTAGTAAATTTACACTAGCTCTAGTAGCAGTGGAAATAACACTATTAACTTAAATCC
TTTTACATAAAACTTTTACCAATAGTATCCTACTATTCCTCTTAGCGATCTTAACGATTC
CGATATAATAAGCTTAGCTAATAATTTATAGCAAGATTATTTGTAATAAAAATCTAAAAT
ATACGAAATGAACAACCCTTTGAGAACAAATGTTACAAATCAAACTGTAGACCCTCTTTA
ATAACTAGTAGAAATAGAATGCTGTAATTAAATACAACTTATCCCTTTGATAGGATAGAA
TTTTCAAATAGCTTAAGGCATTCAAGATTGGTCCTATAGCAAGAAAGGTTGCAAGAATAA
AATTGCAATCCATCTCCTCTCTGGAAGCTAACATTAAGAACTTTAAGTTCTTTTAAAATT
AAATAAAACAGTTGAAATTAAAAAATTTAAGATTGGATTCAATTGCTAGTCTGTTGAACA
ATCAGATTCAGTAAATAAAAAAATTAATTTTTATTTTCTCAACTAAAATTATTTCTTTTA
ATTTTTAATATATTTTAATCCATTGTCTTCTTTTTTTAAATACTTTATAATTAAATAGCA
AAAAATTATTGGAATACCAAGCGGAGTTATTGTAGAAGGAGGCTTATCTGAAAGCAAATT
AGTCCCTTTAGGTTTCCTTCATTAAATTAATGATGATAAATACTTGAATTTCGGCGTTAA
AGTATTTGCTAAAAATTTTGCTAGAGTTAACGATGAGACTGGAAATATTGATAAATGTAT
TAAATCTTTGTCATCACCTAAGGTTAGCTATATTAAATTAAGAATTATTAGACCTATTAT
CACTCTTATTGAAGACTCTTCTTCTTTTGTAAATAAACAATTTGGTAGTATAGCAATATC
AATTAATTTCCTATCAATCATTGGCTATTAAGTAGATCACATAGCCTCAAATTTGTCCTA
ATTTATTTACAAGATATAAACAGACAGCGCTATATAAATCTTAGGAAAATTATGTGGTAA
ATTATGATTAAATTTTTTTATCAAATAAAATTGTGATTAAATATTTATTTTTTATTTTTA
TAGCTGAAGGTATGGGATTTGACAAGACCATATAGTCTATTTCGAATGATAAGCAAATAA
TTTAAAAAATAAAAGACGGATTTGAGTGTGTAGAATCTTTAATTTCTCAATATGAATAGC
CTATATCACAGCTTTTGATTTGTATAGCTTTGAACAATGATGAATTTGCAGATTGGATAT
TTGATTATCTTCTTGATTCAAGTAGAAATAAAACTCCATTGGCAAAGCTCCTAACTGAAA
TAATAATATCTTAAAAGTAACAGTACAATGACAAAGTGTTATCTAACAAAGCTTTGCCTC
GGGTCGAAAAGCTTTATGAATACATAGTTAAGCAGATTAAATAATATTTGGAGAGTAACC
CTACTGATAAAGATATAGAGGTAGATGCAGATGGTATTTTGTCTCTTTCAAGTATTTTCC
CTTTTGTTGATGCATTAATAGCTGCTTTAAGAATTTCGTATCCTCATCCAAAGATGAATC
AAAATGAGAAAGAAAAATATCAGTAAGTTAACTTATAATTTTTATGATTTATTTTTAATT
AATAAATTTAAATTAAACAATAGAGTAAAAGAAATTATGAAATTAAGAGTAAATATAGAA
ATCATATAAAGTCTAATTTCCATCTATTTAAAGTGTGTTAAGTAGAAAGCTGAAGGTTTT
TCAAAATTAAGTATAAAATTACTGGTAAGCTTGTTATATTTACCCCTGCCATTTTACTGT
GATAATTAGGAAAATTTGATTAAGGAATCTCTAAACTTAATTTGGGATTCACTAATTTAG
AAAAAGTAATATTAACTTACAGAATTAATGGTTGTCTTAGCCTACGGAGGAGATTAATGC
CAAAGATGGTTTTTAGAAGACAATCAAAATCATTTTAAATAATTAATTCATAATATTAAT
CAAGAAATGTCCTTAGCTTCTTCAAATGAAAAAAATACATAAAATAATATTTTACAATCA
TAAAATCTAAATAATCAAACTATAACAAATTCTAAGAAAGCAAAAAGTCTTTTCAGTATA
TTGTGCGCTATATCTAATTCTCAAGAAATTTAAAATTTGCTTATATAAACCTCACCTGGA
AACAATAGCTCAAACAATACTAACTAAATTCCAGAGTACATAAAAATATATTCATTGATG
AAGCTCAAAAAATCAGAAAATATATTTTTTTCCTCTACTTCTTCAATAGGATCCTCAAGT
TATAGATTACTCTAAAATTGGGTTGACTAGGAGTTTTTGCAGTTATTTGTGGAGTTTTTG
AAGAAAATATCCTACAGTAAATAAGAGGTGATTGATTCAATTGTGCATGGTCTGATTGAA
GATATTAAAGAACTAGAACACAAGAAAGATCATCTATTTGTTAATGATTTACTTCTTCCT
ATTTTACAATCTATCTAAACAGTCCCTATGTGCTTTCATGCATTTGATTCCCTTCAAAGA
AAGTGGCTAATTAATCCTATAAAAGTATTAAATCATCCTTATTATCTAGCCAAATTTTAG
TAGTCATCAAAAAGTAAAGCCTAAAAAAATATAGATAAATTCAATACTAAGTTATTTAGT
CAAGAATAAAAGTAAGTCTTTATGAAAACATTGAAAAAGTTCACACTCGATACAGGCCTA
TACAAAAAAATTAAAAAGTATGAATGGATTAAAGAGGCAACTTAAGAAGTAGATAGCTAA
TCATCATTGATCAATAAAGTAATTTAAATTTCCTATTCTAAAACTAACAATTTATTAAAA
AAATAAATATTCAAATAGTTGGAAAATAAAATCTTAAATAATCCTCCCTACATAATTGTA
ATTGAAGGTGTCAATAGCGGATAAAAGTGTTTGTGTGGTGTTTTTAGCAGCTAAGCCATT
TAAAAATCTTCACTGGAAAGCACTTTTAATATATCAAACGGAGATGATTGCTTTATCTTT
TACTATAGTGAAAATTATCAAATTCATTTCAGAGTTGAAGGCAACGATTTTGGGTAATTA
GATGTTTCTCCAGAAACAAGTTTTTTAACCTTCAAATATAGAGAGCTTGATCGCATATAT
TTGTCATTCTCAGAAGGAAGCTCCAGTTATGTTGATATAAATATGTTTGATATGAAAGTA
ATAAATTTTTCAAAAATAAAATTGTTTATATTTATTTTTATATTTCTGAAATTTAAAAAG
CCTATCGAAAACAGTCAAAATATTCCTCACGATATTCCAAACGATTTTTCTTTCATAAAA
GCAGAGTATTGGGTTTTAAGACCATAAACAATCGAATTAAGTGAAGATAGGAAACATCCT
TTTAAAATGGAAAATATGTATGACATTTAAAATACATAACACCATCTGTTTAACAGTGAA
TATTACAAACCTGACAATGCTTACAATTTTTACAGATCTCCTGCTGTTTACCATTTCCCA
GAAGATCTTACTTTGCAACAGGTTATAACATAATTAAATGTCCCAGGTTTACAGGTATCC
AAAGAAGTTCTTTAGCAATTCTCCTTCAATTTAAGATAAAGTGCTAAATTTTTTTCATGC
AAAGATAACATCAATCTTAGAAGCCTTTACCAAGAAATAGATAAGAATTCAAATGGAATT
ATAGACTTAGAATATAATGTTGATTAATTCTTCCAATAAGCTCCTAAAATTCAATAGCTA
TCATAGCCTCAATAAATAGAATAATAAAATTTAGGTATATTTTTATTTTGAATAAAATAT
GATTTAAAAAAAATTGAAATTGAAAAAAATTAACCAATTTTATATTATTTTTTATTTAGA
TAATCAAAAATAGAATAAGATAATTGATGCTTTTATAGATTAGAAAGGATTTAAAACTAT
TATATCTGTTATTAAAGAATAGCTAAATAGCTGGAATAGTAAAACAAGAGCTAAAAAATG
GTTAGTTTATGTTCAAGAATTAAATACATTCTCTGTTCTTCCCAACTTCATTTATGAGTT
TATGAAGAAAAAGGAAGGAGTGAATATACTTTTCCAACTCTTATCTGGATCTCTAGATTC
TTCAAACGAATTAAAATCAGAAAAATAAGAAGATAATAAGATGCATTAAATGAAATAACC
TTTACTAGATGGGCTCTCTGAAGATTACCCAATCACAAAAGCATTTAAAAAGAGTTATTA
CAGTTAAGAAAAGAATAAAGAAGACTTTGAGAAAAACAAATAATTTGAGGAATAAGAAAG
AAATGCAGTTTAAAATATTTATGAAATTCTTTCATAATTATTCTAATAAGATAAAGATAA
TCATAAAATAAAAAGTATTGCCATAGAAAATAATATATTGTAGATAATATTTGATAGAAT
TTCTTCAGTTTCCAAGGAGAAACCTCGTAAATTCATTGAAAATACTCCTGCCTAAGATAA
AAAGTTGAGCGATGATGATAATAAATTAAAATTAGACTCTCCTATCCTTATTATGGGAGT
ATAAAGAACAGGATAGGGAGAAAAAGATGAAAAATCTCGCTCTAATTAGAATGTGGACAA
AAAGAAAAAGGGTAAATTTTAGTATAATTTATTTTTCAATATTTATTATGATATTTAATT
AAAAGGTACTGGATATGCTTCAGATAATACTGGATAAAACCAAAAGTGGAATACAAGCGA
ATATGTAGAGATAAATAAATCTAGAAATCAGCTTCTTCTAAGTTTGATGAAAATATTATA
AAGCTTCTTTAACTTTGAAAGCTGGAGTATTCCAAATAAAGTAATTCATTCTATCTGTGA
AAGTAGTCTTCTTCCATTATTAGAGAGCGCTTTTAGGAGTGGCTCTTTACTTGAAATATG
TAAAGAAAGTTAATTGATGATATAATACTTGCAGCTCATAGAAGTGATGTCCTAAAATAA
AAGTTTGATTAAATGTCTCATGAAACTTGACCAAAGATACCAGCCTACATAGACTGAAAG
TATAAGTGAACTTCTAAGTAAGCTTCGTACTACTGCAGAGATATTCTTAAATTGCATCAA
ACCAGTACAAATATAAGTACCTGAAAGTACAGTTAAATCTTCAATATCTATATAAAAAGA
CATGCTAGCTCAATCAAATGCTAATTTATTAAAATAATGGGGAGCTGATAAAGACATATG
TAAATATTTTGGATTAATTTAGATCATTAAAAATTAAATTTTTAATTAAATATTTAAATT
ATTATCAAACTTAGTGAATGAAGAAAAGAAATTTTAAAAAATCCTGAATGATTAAGAAGA
AGGCAATCTTTAATCTTAATAAGTTGCTACTAGTATAATTTAGGTGCACGAGAAATTAGA
TTAAGCTATTCAAGAATTTAATGAACATATTCAAGAATCAACCTCACAAAATTTTTCTAA
TTTAGATCAAGAGTAAGATGAAGGATAAGAATAAATCTAAAAAGTATAGCGTGTTTTAGA
ATTACCTTTGAATGTAAAGTATAAAATACTGTTAGAAAAGCTGAGATTCGGATATTTTTC
TATGAACAACAATAACTTAAACACAGTAAAATACCTTTTAAAATAATTAATTTTTGAATT
AATTTTAAAATTAACATAAAAATAGTATAATCATCACTACTAATAGTAAATCATGCAGAA
CTAAAATCCATCATAGGTTAAAATGGTTAGATTAGCATAAGAAATTGCAGATATGGCTAA
TTCTTTACCAATTGATCATACAAGCAGTATATTTGTTAGATGCGATTCCAAAAGAGTAGA
TGTCATGAAATGTATAATCATGGGTTCCTCAGGAACTCCATATGCTCATGGTGCTTTTTT
ATATGATATTTTCTTTGAAGACTCTTATCCTAATACATCACCAAGAGTTAATCTTTAAAC
AACTGGCAACAATAAAGTGAGATTCAACCCAAATTTATACAATTGTGGAAAAGGTAAATA
AAAACAATGTTAAATCTCATTTCATTTGAAAATTATTTAAAAAAAATAGTTTGCCTTTCT
TTATTAGGTACTTGGAAAGGATAAGCCAGCGAAAATTGGGATCCAAAAATAAGCACTTTG
CTTTAAGTTTTAGTCAGCCTTTCAGCTATTATCATGAATGAAGACATTTACTTCAATGAA
CCTGGGTATGAAGGACATAGTGGAACTGAAGATGGAGATAGAAAAAATGAAGCTTATTCT
AATATTGTGCGTTTTAGTAATATTAAATATGCTATGATATAAACCATAAGAAACCCACCT
GAAGGTTTCGAAGATGTAAAATTTTATATAATAGAGCTATGAAAAAATTATCTAATGCTT
TTATAATTTTTATATTTAAAGGTAATTAAAAGACATTTCTATCTTAAGAAAGATGAGATC
TTAAAAGAATGTGAGGGATGGATAGAAAGAAGTACAAAAAAATAAGCAAGTTATGTTGGA
TTGGTCAGTGATCACAACCCTTAAATTTGTTAAGAATTCAAATAGCCAAATAAATATACT
GAATAACTCAAGCTAGCAGTTTAAGATTTGAGGCAAGAATTAGAAAAACTAACTCCTCCA
TCTTCAATAGAAACTTAAGAGGAATTAGCTAAGAAAAAAGCCAGAAGCCAAAAACAACAT
GAAAAGAAATAAAATTTAAATAAATAAAATAATTAGAAATAAAATATACCAACAGCAGTT
TTACACAATGCTTTAGACGATTTATAGTAACAAGAAATACCTATAAAGAATAATAAAATT
AATAAATAAGAAGAGATTGATGTAGAAAGTGAAGAAGTAAAAGATAGATGGTCAAGATAT
ATTTGCGCTATGGGTATAGATGCTGTAGCTAAATAGAGTAAATGCAACATTTTCCTGAGT
GGTTTAGGACCATTAGGAGTTGAGATTGCAAAAAATATTGTTTTAAGTGGTGTGAAAAAA
ATGACTTTGCATGATAACCATATCGTAAATTATAGAGACTTAAGTGGACAGTTTTTCTTA
AAGAAAGAATGTGTTGGCAAAAACAGGGCGGAAGCTTGCCTATAAGATATATAACTCCTC
AATCACTATGTTCGTGTGGATACGAATGTTAATTAGGTTAATGCAGATACTTCAACATTA
TTAGAAAAGTTGTATTTATAAGATTATCATGTAGTAATTATAACTGAGTGTTATTCTTTA
GATATCCTTACAGCAATCAATACTTTTTGTAGATCTAGATCTATTAAATTTATATACACT
TAGGTTTAGGGACCTTTTGGTTTACTCTTCAATGATTTTGGAGATAATTTCGAAGTAATT
GATAAAAATGGTGAAGATCCTGTTGAATTAGTTATTTAAAATATATAATAAGTTTAGGCT
GGTGAAAAAAGCAATAAACTTAAAGTAACTTTATTACCTGGCTTTAAGCACCCTTACGAA
GATAAAGATAAGGTGATTATAAAAGAAGTACAGGGTATGCAAGAAGTAAATAACTAGAGT
AAATCAATAAATGACTCTATTTTCGAAATTGAAACAATAAACTCAAATAGCTTTTATATA
CTCACAAATAATTTATACTCACCATACTAAGGAAGTGGAGTTGTTAAAAATATTAAAACT
CCAATTTATCTTTCGTTTTAGTCTTTAAAGCAATGTATTTAGGCAAATAATATGGAATAT
TTTGATGCAAATATGGCTTCTCATGATTTTGAGAAAATGGACACCATACCATATCTCCAC
ATTGCATTTTAAGCACTTTAAGAATTTATCCAAATAAATTTCAGGTATCCTCACCCATGG
AATTAAAAAGATGCTTAAACTATGTTAGAAATTTCTAAAAGTCTTTATGGTGCATTTGAC
ATTCCATAGAAAGAAGATGAAAAAAATAAATTAAAATTTGAAGAATACATAAACAAATTC
TCATTTACTGTATCAGGAACTTTTCATCCTTTGGTAAGTTTATTTATTTATCTTTATAAT
TCTTTTGTATTTAAAATATATTAAATTTATTAATAGTGTGCGTTTATGGGTGGATATGTT
TCTCAGGAGGTAATTAAAGCTATAACAAATAAATTTGTGCCTACAAAATAACTCTTCTTG
ACAGACTGTATCGAAGTTTTACCAGATATAAACTGGAGCGATAAAAAATCTTCTGAAGAA
TAAATTAGTAGATTGTAAAGTTAATTTGAAAATGAAAAGGAATTTGAGGTATAAAATGAA
CTGTAATTAAAAATTGTAATTGGTAGCGAAACTTCTGAGAAACTTTCTCATTGCAAACTC
TTCATGATAGGCAGTGGAGCGATCGGCTGCGAGCTCTTAAAAAACTTTGCTATGATCAAC
CTTTGTACTGGAGAAGAAATTCCAGAAAGAAATTTGAGGAAAGGATAACTAACATTAACA
GATCCAGACCATATTGAAACTTCTAATTTAAATAGATAATTTTTATTCCGTGAAGAGCAT
TTAAGAAAACCAAAATCTTCTACAGCAGCACAAGCAGCAATTAAAATGAATAATAAGCTT
AAAAACCATATTGTAGCTTGTTTGGATAAAGTCTGCGAAGCTACGAAAAACATCTTCTCT
GAGGAATTTTTTGAAGATTAAGACATAGTGGCAAACGCTCTAGATAATGTTGAAGCCAGA
AGATATGTAGATAAAAGATGTGTTTCTTCTAAAACTCCTTTACTTGAATCTGGAACTCTA
GGACCAAAAGGACACGTTTAAGTAATTATATTAGACTGTTTTATTTGATTAATATATATT
ATTTCATTTAGGTTATCATTCCTTATAAGACAGAGTCATATGGAAGTCAGTAAGATCCAT
AAGAAGAAGGTGGAGATATTCCTCATTGCACTCTAAAAATGTTCCCTGAAGAAACTTTAC
ATTGTATTGAGTGGGCTAGAGATAAATTCGGAAAAATAATTACTTTAAAGCCAAAAATTG
TATAAAAAACTCTAGATGAGATAGAGAATATCAAAGAAGGAAAAATTAGCTGTGAAATAA
TTAATTTGAGAAAGACTCTAAAGGCACTAAAAAATAGACCTCTTTCATTTGAAGATTGCA
TAGAATACGCAGTTTAGAAATTTTATAAGTTATATAGAAACAATATAAGATAACTTTTAT
ATACTTACCCTCTTAATCATAAGAACAAAGATGGCAGCGATTTTTGGAAATTACCAAAAA
GAGCACCTTTCGAAATTTCATAACTGGATGAATAAAATCCTCTTCACAGAGACTTCATAG
TTGCATTATCTGTAATGAGAGCAAAATCATTTAATATTCCTTATCCTTAGAGCTTTAGGT
AGCAATCAGAAAAAATATAAATTATGCAAATAGCTATGAATTGTAAAATTGCCGATTTCT
AACCATCAGATGAAAAATCTACTGAAATTAAACAAGAAGTCAATTAGGAGAACGATAAAA
CATAAGAATAAGCTAGCATTAATTAATAAGAAATTAGCCAGATACAAACAGAAACTAACT
AAAATAATATAAATGAATTAAAATAAAACTAAATTATTTCAAATGATGAAAATCCTAATT
ACCTTATAGAGTAAATCCTACTTTAAAAGTTAAATCTATAATAGTAAACTTTTATGCATT
CTGAAGAATTCGAAAAAGATAATGACTCTAATGGGCATATTGATGCCATCTATGCCATGG
CAAATCTTAGGTCCATAAACTACTCTTTAACTCCTATGGATTGGATTAATGTTAAATTGA
AGGCAGGAAAAATTGTGCCAGCGCTTGCAACCACAACTGCAGCAATTGCTGGATTGCAAA
CTATAGAATTAGTAAAAACATTAAAGAAGGTAGATATATGCAAAATGAAAAATGCTTTCC
TGAACTTGGCTGTACCTTCTTTATAACTTACTGAACCAGCAGGTCCTCCCTCCTTTTAGA
TTACTAAAAATTTAAAAGCAAGTATTTGGGATAGATGGGATGTTTGGTTAAATAAGTAAG
ATAGCCTAAAAAAATTATTTAATTACTTTGAAGAGAAGATGTAATTAAGTCCATTTAGCA
TTTTAATTGGAACAGACCTCATATATTCTTTTACAATGAATACTGAAGATAAGTAATTTA
TACAAGATAGTACATTTTCTGAGGTGCTTAATAACAACAATTAATTAATTTTAAGCGAAG
CTAAATATATAGATCTAAATATTTTATTCACAGAATTAAATGGTAATCAAATTCTTCTGA
ACACTCCTTCTGTAAGACTATTTTTCGGTGTTAAGGAAGAAAAACAATAATGA