Identifiers and Description

Gene Model Identifier

TTHERM_00997780

Standard Name

UBA1 (Ubiquitin-Activating enzyme; UBA1 ortholog)

Aliases

PreTt25003 | 188.m00079

Description

ubiquitin-activating enzyme E1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00899 ) ThiF family
  • ( TIGR01408 ) ubiquitin-activating enzyme E1
  • ( TIGR01766 ) transposase, IS605 OrfB family
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( PF02134 ) Repeat in ubiquitin-activating (UBA) protein
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF
  • ( TIGR00984 ) mitochondrial import inner membrane, translocase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00997780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_181720
WormBaseWBGene000066999.997093137033517e-262locus:uba-1 status:Confirmed
UniProt:Q3S1J5 protein_id
:CAJ30225.1
Tetrahymena borealisEI9_20921.19.997093137033517e-262ubiquitin-activating enzyme E1
family protein (1038 aa)
DictyBaseDDB_G02702729.997093137033517e-262uae1 on chromosome: 1 position
4544769 to 4548249
OxytrichaContig20907.0.g369.997093137033517e-262ThiF family
SGDYKL210W9.997093137033517e-262UBA1 Ubiquitin activating enzy
me (E1), involved in ubiquitin
-mediated protein degradation
and essential for viability

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00997780(coding)
ATGGCTGAGACTGGAAAGATTGATGAAAACTTGTACTCAAGAATGATGGGTGCATACGGA
GTTGAAGCTGTAGGAAAGTTAGTTAAGCTAAAGATTTTCCTATCAGGCCTTAGAGGTGTT
GGTATCGAAACAGCAAAGAATTTAATTTTAAGTGGTCCCTCTGCAGTTTGCTTGCACGAT
GATAGCCTTGCTGAAGTTGCTAATATGGGCTGCAATTTCTATCTAAAGCCTGAGCATATT
GGTAAAGTTACTCGTGCTGAAGCTTCTCTTCCTTAATTAAAGGAATTAAATCCCTATTGC
AAGGTTTCAGTTCACACTGGTTAAATTACAAAGGAATTATTAGCAGATTTTGATGTTGTT
GTTATCACTGACAATTACAACCAAGATGAAATTGTTGATATCAATGCTTACTGCAGAGCT
AATAAAAAGGGTTTCATATATTCAGGCATCTTAGGTCTTTACGGCTTGTGCTTTGTTGAT
TTTGGTGATAGCCATTCAGTTTTTGATACAAATGGTGAAGAACCTCGTAACTCTATTGTT
GTTGGTGTTACCCAAGATGCTGAAGGTTTAGTTACAGTTCATGAAGACAAGAGACACGGT
TTCTAGTCTGGTGATTACGTTACATTCAGAGAAATCTAAGGTATGAGCGAATTGAACGAC
AAGGTTTTCAAAATTGAAGAAAAGAGTCCCTTCACTTTTACTCTTGTTGGTGTTGATACC
ACCAAGTTCTAGCCTTACTTACGTGAAGGTATTGTTGAATAAGTTAAGGTTCCCGTCTAG
ATTGCTTTCAAGAGCTTGGGCGAAAGTCTTAGCAAGCCTTATGCTCCTGGCAAGAATGAA
TTAGATATTTGTGATTGGGAAAAGTTTGGTAGACCTGAATAGCTCCATTTAGCTTTCACT
GGTTTATTGACTTTTGTTAAGCAAAATGGCCACCTCCCTGCTCTTCATTCTTAGGAAGAT
GCTGAAAAGCTTCTCCATATTGTTAAGGATATTAATACTCAAAGAAAAAACATTGACGAA
GAAGGTGTCCTCAAGGTAGAAGAAATTGAAGAGTAAATTGTTAAAAATATTGCTCTCTAT
GCTCGTGCATAAATTACTCCTCTTTCTTCTTTCTGGGGTGGTATTGTAGCTCAAGAAATT
GTCAAGTACACAGGTAAATTCACTCCTCTTAGATAATGGTTGCATTATGAATGCTTCGAA
GCTCTTCCCGAAGGTGAAGTAGATAGAACTTTATTGAACTCTCAATATGATGACTAGATT
GCTATCTTTGGTAGAGAATTCTAACAAAAGTTACTCGAACAACGTACTTTCTTAGTTGGT
GCTGGTGCTTTAGGATGTGAATATATTAAAATGTTCGCCTTGATGGGTTTGGGAAGTGAA
AAGAATGGAGGTGTTGTCGTTACTGATGATGACTAAATTGAAATGTCCAATCTCAATAGA
TAGTTCCTCTTCCGTAAGGAAAATATTGGTCACTCCAAGTCAGAATGTGCAACTCGTGCT
GGTAAAATAATGAATCCTAAGCTTCACATCGAAGCTCTTAAAGAAAGAGTTGATCCTGAA
AATGAAAGAATCTTTAACGATGCTTTCTGGGAGGGTCTCGATTTCGTAGTTAATGCTGTC
GATAATGTAAAGGCTCGTCTATTTGTCGATGGACGTTGCGTTTGGTATGGTAAACCCCTT
TTCGAATCAGGTACTCTAGGAACTAAATGTAACTCTTAAATAGTTCTTCCTAAGCTCACT
TAATCTTATGGTGATTCTGTTGATCCTCCTGAGGAATCCATTCCTTTGTGCACATTGAAG
AACTTCCCTTACCAAATTGAACACACTATTTAATGGGCTCGTGACTATTTTGAAGGTAAC
TTGGTAGAAGGTCCTAATGAAACTTCAAAGTATGTAGAAAATCCTCAAGCCTACATTGAA
TAAGTAACTAAAGAACTTCGTAGCAAGCCCGTTATGTTGAGAGGCCGTTTGGAAATTGTT
AAGAAATTGGCAACTGCTTACTCTGGTAACCACTACGACAAGTGCATTGAACTCGCAAGA
CACATGTTCTAAGATATTTTCTATAATTAGATTTCTTAACTTCTCTACTCTTTCCCTCTT
GACCACAAGACTGAATCAGGCTAACCTTTCTGGTCAGGACCCAAGAGACCTCCTATTCCT
ATTAAATTCGATACCAATGACGATATTCATGTCGACTTTATTTAATCTGCTGCTAATGTA
TTTGCATTCATTTTCGGTCTCCCTTACTGCCATGATAGGGAATACGTCAAGAAGGCTGCA
AACTCAGTACATGTTGAAGAATTTGTTCCTAAAAAAGCTAGCATTAAGGTAGACGATAAA
GATAAAACTGAAGAAAAAGTCGAAGACGATGAAATTGTCATTGAAAACTTAACCAAGGAG
TTGTTGAATTTCAATCTCTCTTAAAATAAGCCAAAATTAAATCCTATCGAATTTGAAAAA
GACGACCCAACCAACTGGCACATTGATTTTATTTCATCTGTTGCTAACTTACGTGCCCGT
AACTATAAGATCAAGGAAGTTACCAAGTTTAAGGTTAAAATGATTGCTGGTAAAATTATT
CCTGCTCTTGCTACAACCACTGCCATGGTCGTAGGTGCTGTCGGTATTGAAATCTTCAAA
TATATACTCTAAAAGCCTCTTAACAAGATGAAAAACTCCTTTATGAATCTTGCTCTTCCC
TTATGGATCTTCTCTGAACCTGAACCTCCCATTAAGGCAAAGGATAAAGATTATGATCCC
GTATTGATGGGACCTGTTAAGGCTATTCCCTCTGGTTTCACTACATGGGATAAGCTCTTC
GTCTAAGGTCCTCTTACTATTTAAGGTCTTAAGGATTATTTCAATGATAAATATCAAGTA
AATATCTCCATTTTATCAGTTGGTAAAATCTGTCTCTACAATTCATACATGACAGAGGCT
GCTGAAAGAGAAAGTTGGGATATAGCTCAAGGAGTTGAAAAGCTTGGAGGTTAACCTATT
CCAGACTTTAAAAAGTTCTTAGAATTAGAAATCTGTGCTGAAACTCAAACTGGTGAAGAT
GCCCTTATGCCCACAATTAAGTATGCATTCAAAGCTTGA


>TTHERM_00997780(protein)
MAETGKIDENLYSRMMGAYGVEAVGKLVKLKIFLSGLRGVGIETAKNLILSGPSAVCLHD
DSLAEVANMGCNFYLKPEHIGKVTRAEASLPQLKELNPYCKVSVHTGQITKELLADFDVV
VITDNYNQDEIVDINAYCRANKKGFIYSGILGLYGLCFVDFGDSHSVFDTNGEEPRNSIV
VGVTQDAEGLVTVHEDKRHGFQSGDYVTFREIQGMSELNDKVFKIEEKSPFTFTLVGVDT
TKFQPYLREGIVEQVKVPVQIAFKSLGESLSKPYAPGKNELDICDWEKFGRPEQLHLAFT
GLLTFVKQNGHLPALHSQEDAEKLLHIVKDINTQRKNIDEEGVLKVEEIEEQIVKNIALY
ARAQITPLSSFWGGIVAQEIVKYTGKFTPLRQWLHYECFEALPEGEVDRTLLNSQYDDQI
AIFGREFQQKLLEQRTFLVGAGALGCEYIKMFALMGLGSEKNGGVVVTDDDQIEMSNLNR
QFLFRKENIGHSKSECATRAGKIMNPKLHIEALKERVDPENERIFNDAFWEGLDFVVNAV
DNVKARLFVDGRCVWYGKPLFESGTLGTKCNSQIVLPKLTQSYGDSVDPPEESIPLCTLK
NFPYQIEHTIQWARDYFEGNLVEGPNETSKYVENPQAYIEQVTKELRSKPVMLRGRLEIV
KKLATAYSGNHYDKCIELARHMFQDIFYNQISQLLYSFPLDHKTESGQPFWSGPKRPPIP
IKFDTNDDIHVDFIQSAANVFAFIFGLPYCHDREYVKKAANSVHVEEFVPKKASIKVDDK
DKTEEKVEDDEIVIENLTKELLNFNLSQNKPKLNPIEFEKDDPTNWHIDFISSVANLRAR
NYKIKEVTKFKVKMIAGKIIPALATTTAMVVGAVGIEIFKYILQKPLNKMKNSFMNLALP
LWIFSEPEPPIKAKDKDYDPVLMGPVKAIPSGFTTWDKLFVQGPLTIQGLKDYFNDKYQV
NISILSVGKICLYNSYMTEAAERESWDIAQGVEKLGGQPIPDFKKFLELEICAETQTGED
ALMPTIKYAFKA


>TTHERM_00997780(gene)
ATGGCTGAGACTGGAAAGATTGATGAAAACTTGTACTCAAGAATGATGGGTGCATACGGA
GTTGAAGCTGTAGGAAAGTTAGTTAAGCTAAAGATTTTCCTATCAGGCCTTAGAGGTGTA
AGATATTAATTTTCATCATTTTATTATTCTTCTTGTCAAAAAAAATAAATAAATAAACAA
ACAAATAAACAAAAAAACATACGTTATGGCAATTTTAAATACTTTTTGATTGAGATTATC
TCTACTAATACAAAAAATACAGTTTTAGAATAACTGTTAACCATTAAACATGCTTAAACT
AAAGATAACGCTAGTTTTTTTAATGTTTTAAAGACAAAATCAAAAAATTATGCTAAACAG
TTTTTATTTTAAAAACGAACGATATCTTATTTAAAAATAGGTTGGTATCGAAACAGCAAA
GAATTTAATTTTAAGTGGTCCCTCTGCAGTTTGCTTGCACGATGATAGCCTTGCTGAAGT
TGCTAATATGGGCTGCAATTTCTATCTAAAGCCTGAGCATATTGGTAAAGTTACTCGTGC
TGAAGCTTCTCTTCCTTAATTAAAGGAATTAAATCCCTATTGCAAGGTTTCAGTTCACAC
TGGTTAAATTACAAAGGAATTATTAGCAGATTTTGATGTTGTTGTTATCACTGACAATTA
CAACCAAGATGAAATTGTTGATATCAATGCTTACTGCAGAGCTAATAAAAAGGGTTTCAT
ATATTCAGGCATCTTAGGTCTTTACGGCTTGTGCTTTGTTGATTTTGGTGATAGCCATTC
AGTTTTTGATACAAATGGTGAAGAACCTCGTAACTCTATTGTTGTTGGTGTTACCCAAGA
TGCTGAAGGTTTAGTTACAGTTCATGAAGACAAGAGACACGGTTTCTAGTCTGGTGATTA
CGTTACATTCAGAGAAATCTAAGGTATGAGCGAATTGAACGACAAGGTTTTCAAAATTGA
AGAAAAGAGTCCCTTCACTTTTACTCTTGTTGGTGTTGATACCACCAAGTTCTAGCCTTA
CTTACGTGAAGGTATTGTTGAATAAGTTAAGGTTCCCGTCTAGATTGCTTTCAAGAGCTT
GGGCGAAAGTCTTAGCAAGCCTTATGCTCCTGGCAAGAATGAATTAGATATTTGTGATTG
GGAAAAGTTTGGTAGACCTGAATAGCTCCATTTAGCTTTCACTGGTTTATTGACTTTTGT
TAAGCAAAATGGCCACCTCCCTGCTCTTCATTCTTAGGAAGATGCTGAAAAGCTTCTCCA
TATTGTTAAGGATATTAATACTCAAAGAAAAAACATTGACGAAGAAGGTGTCCTCAAGGT
AGAAGAAATTGAAGAGTAAATTGTTAAAAATATTGCTCTCTATGCTCGTGCATAAATTAC
TCCTCTTTCTTCTTTCTGGGGTGGTATTGTAGCTCAAGAAATTGTCAAGTACACAGGTAA
ATTCACTCCTCTTAGATAATGGTTGCATTATGAATGCTTCGAAGCTCTTCCCGAAGGTGA
AGTAGATAGAACTTTATTGAACTCTCAATATGATGACTAGATTGCTATCTTTGGTAGAGA
ATTCTAACAAAAGTTACTCGAACAACGTACTTTCTTAGTTGGTGCTGGTGCTTTAGGATG
TGAATATATTAAAATGTTCGCCTTGATGGGTTTGGGAAGTGAAAAGAATGGAGGTGTTGT
CGTTACTGATGATGACTAAATTGAAATGTCCAATCTCAATAGATAGTTCCTCTTCCGTAA
GGAAAATATTGGTCACTCCAAGTCAGAATGTGCAACTCGTGCTGGTAAAATAATGAATCC
TAAGCTTCACATCGAAGCTCTTAAAGAAAGAGTTGATCCTGAAAATGAAAGAATCTTTAA
CGATGCTTTCTGGGAGGGTCTCGATTTCGTAGTTAATGCTGTCGATAATGTAAAGGCTCG
TCTATTTGTCGATGGACGTTGCGTTTGGTATGGTAAACCCCTTTTCGAATCAGGTACTCT
AGGAACTAAATGTAACTCTTAAATAGTTCTTCCTAAGCTCACTTAATCTTATGGTGATTC
TGTTGATCCTCCTGAGGAATCCATTCCTTTGTGCACATTGAAGAACTTCCCTTACCAAAT
TGAACACACTATTTAATGGGCTCGTGACTATTTTGAAGGTAACTTGGTAGAAGGTCCTAA
TGAAACTTCAAAGTATGTAGAAAATCCTCAAGCCTACATTGAATAAGTAACTAAAGAACT
TCGTAGCAAGCCCGTTATGTTGAGAGGCCGTTTGGAAATTGTTAAGAAATTGGCAACTGC
TTACTCTGGTAACCACTACGACAAGTGCATTGAACTCGCAAGACACATGTTCTAAGATAT
TTTCTATAATTAGATTTCTTAACTTCTCTACTCTTTCCCTCTTGACCACAAGACTGAATC
AGGCTAACCTTTCTGGTCAGGACCCAAGAGACCTCCTATTCCTATTAAATTCGATACCAA
TGACGATATTCATGTCGACTTTATTTAATCTGCTGCTAATGTATTTGCATTCATTTTCGG
TCTCCCTTACTGCCATGATAGGGAATACGTCAAGAAGGCTGCAAACTCAGTACATGTTGA
AGAATTTGTTCCTAAAAAAGCTAGCATTAAGGTAGACGATAAAGATAAAACTGAAGAAAA
AGTCGAAGACGATGAAATTGTCATTGAAAACTTAACCAAGGAGTTGTTGAATTTCAATCT
CTCTTAAAATAAGCCAAAATTAAATCCTATCGAATTTGAAAAAGACGACCCAACCAACTG
GCACATTGATTTTATTTCATCTGTTGCTAACTTACGTGCCCGTAACTATAAGATCAAGGA
AGTTACCAAGTTTAAGGTTAAAATGATTGCTGGTAAAATTATTCCTGCTCTTGCTACAAC
CACTGCCATGGTCGTAGGTGCTGTCGGTATTGAAATCTTCAAATATATACTCTAAAAGCC
TCTTAACAAGATGAAAAACTCCTTTATGAATCTTGCTCTTCCCTTATGGATCTTCTCTGA
ACCTGAACCTCCCATTAAGGCAAAGGATAAAGATTATGATCCCGTATTGATGGGACCTGT
TAAGGCTATTCCCTCTGGTTTCACTACATGGGATAAGCTCTTCGTCTAAGGTCCTCTTAC
TATTTAAGGTCTTAAGGATTATTTCAATGATAAATATCAAGTAAATATCTCCATTTTATC
AGTTGGTAAAATCTGTCTCTACAATTCATACATGACAGAGGCTGCTGAAAGGTAAATTAC
ATTCATTTATTTATTTATTACATTTTATTTAAATTTTTAAAATTATAAACAGAGAAAGTT
GGGATATAGCTCAAGGAGTTGAAAAGCTTGGAGGTTAACCTATTCCAGACTTTAAAAAGT
TCTTAGAATTAGAAATCTGTGCTGAAACTCAAACTGGTGAAGATGCCCTTATGCCCACAA
TTAAGTATGCATTCAAAGCTTGA