Identifiers and Description

Gene Model Identifier

TTHERM_00256950

Standard Name

TXR1 (Trithorax-related protein 1)

Aliases

PreTt25381 | 22.m00326

Description

SET domain containing protein; homolog to Arabidopsis ATXR5 and ATXR6.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00256950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10415.19.997093137033517e-262SET domain-containing protein
(642 aa)
OxytrichaContig14985.0.g51.000159011384939e-43SET domain
DictyBaseDDB_G02824270.00000000009998509410508463DDB_G0282427 on chromosome: 3
position 5755702 to 5758268
WormBaseWBGene000026370.000000009996807949091551locus:let-418 Protein let-41
8 status:Confirmed UniProt
:G5EBZ4 protein_id:CCD62685.
1
SGDYJL168C0.00000006998394348458725SET2 Histone methyltransferase
with a role in transcriptiona
l elongation, methylates a lys
ine residue of histone H3; ass
ociates with the C-terminal do
main of Rpo21p; histone methyl
ation activity is regulated by
phosphorylation status of Rpo
21p
Stentor CoeruleusSteCoe_17440.0024787521766663585

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:24382802: Zhang C, Gao S, Molascon AJ, Liu Y, Andrews PC (2014) Quantitative proteomics reveals histone modifications in crosstalk with H3 lysine 27 methylation. Molecular & cellular proteomics : MCP 13(3):749-59
  2. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79
  3. Ref:23150054: Zhang C, Molascon AJ, Gao S, Liu Y, Andrews PC (2013) Quantitative proteomics reveals that the specific methyltransferases Txr1p and Ezl2p differentially affect the mono-, di- and trimethylation states of histone H3 lysine 27 (H3K27). Molecular & cellular proteomics : MCP 12(6):1678-88

Sequences

>TTHERM_00256950(coding)
ATGAATGATTATGAATCTTAATTAAAATAATTGATTATAAATCACTTTATAAGGATAAAG
CAATAGATAATTTATCAATAAAAAAATAAATCCAAAAAAATTAAATTAAGAGTCTTATTA
TTTAAAAAAAAGAGCAAATAACGAAAAAGTTATTTCGAAAAGAGAATAATAATTCTACGA
TAATACTAATAACCAAGTAAGAGTAAATTATAAATGGGACGTAAGAGAAGAGCTATGAAG
GCTAAATTGGATTAATTTTTGGAATACATTCATTCTTCGGAGGAAAAGATGACCTAGGAG
TAATATCTTTAACTCGTAAGAGAAAAGGTGAAGTAATTTTCAAAAAAAGATCTTAAGTAG
ATTCAAACAAATTACATTCTGGAAAAGATCTGTGAAGTATGTAATGACTATCATCACGAT
GAATAACTACTCCTCTGCGATTACTGTGATGATGCTTATCATTCTTTTTGCCTCAACCCA
CCTCTTAAGGAAATTCCTGATGAAGAAGAAGATTGGTTTTGTCCAGTCTGCGTTGAATAA
AAATATTAAATGGAAAAAGAGAAAAGAAGCAGTGGAGGAAGGAGATCTAATTCAAAAGTA
CAAAAACTGCTCGAGTAGTTTAATTTTAAAAATTAAAGAGATGTTGCTTAAAAGATACAG
ATTTGTGGAAAATGTGATGATATGATTCTCTACATGGAGAACGAAGGTGTGATTGAAGAA
AGCGAGAAATGTATCAAATGTAATAAAATGTATCACAAAGAGTGCTTCAGTAAAAAGAAA
GAATCTATTTTATGCAATTCCTGTCAAACGCTTATCAAAAAATAAATCCCTACTGATTAG
AAACTTATCGAGGATTACTTCATTAGAGGATAGCAAGAATCTTTGGGTAATAAACCCTAC
GAATAGGATGATAAGAAGTCAGATAAAAAAAATAAAGCTACTCAGGATTCTAAGAAGATG
ATTAATGAAAATAAAAAGGAGAAGCAGGATGATGAAAGTGATGATGAGATACTTGATGTT
GATGCTCTTAAAGAAATGGAAAATATGAGATAAACTCGTGGAAGAAGAGCTAAATTGTTG
TAAGAAAAAGAATAAAAAGAATAAAAGTAAAGTTAAAAAACAGATAAATCTACTAAAGTT
GAATAACAAACTCGCATCACTAGATAAAGAACTCAAGAAAAAATAGATAAATTAAATGAT
TAATATATTAACGACTCAAATAAAACAGTTAACTCTGTTTTGGCTAAAAAAAGAAAGAAA
AATGATTCTACTGAATTTATAAGTAATAAAACTTAAATTAACGATGACTCTTTGACTCAA
CCACTGGCTATTAACTAAAAATCTAGCAGCAGCAGTAGTTATTATAATGACGACTGCGAG
TCTAATATGTCTACAACTTATTCATCAACAAGCAATGAAACATAAGCTAAAAACACTACT
GCACCTATAAATTCAAAAGGAGGAGTTAAATTCCTACTTCCAGTTCCAAGCTCTAATCCA
ATTGTTAATTTAGAATGCAAGCAATCTTTAATCTATGCTTTGAAAGCTAAAAACATCTAA
TTCTGCGACGATTTGTGCTACACTTAACAATGCCCTAAATAAAGCAATAATGCTAATTTA
GAACCAAATTTGTAAGTAATTGATCTTGCAAATAGCATTATATTCTAAAAATTCAAAGAA
ATGAGCAGATAGGGGATTTATGCTCCTGTTGTAGTAGAAGAAGATAAGATACAAGGATTT
ATAGTAAGAGCTATGGATGATATAAAGGCAAAGACTTTAATTTGCGAATATGTTGGTGAG
GTCGATTATGCTAGAAACCACATCTTCAACAAAAACGACTCTATTATGGATCTTTTGAGA
ACAGCTAGATCAAAAACATCATTAGTAATTGTTCCTGATAAAAAAGGTAACCTTGCTAGA
TTCTTATCAGGAATTAATAATACTTCTAAAAAATCTATGGCTAAACAGAATGTCCACAGT
GTTAGATTCAACATTAATGGAGAATCAAGAGTAATTTTATATGCCAAAAGAAACATAAAA
AAAGGAGAACTTCTATATTATGACTACAATGCAGGAGGATTTGGAGAGTATCCAACATAA
AATTTTGTATGA


>TTHERM_00256950(protein)
MNDYESQLKQLIINHFIRIKQQIIYQQKNKSKKIKLRVLLFKKKSKQRKSYFEKRIIILR
QYQQPSKSKLQMGRKRRAMKAKLDQFLEYIHSSEEKMTQEQYLQLVREKVKQFSKKDLKQ
IQTNYILEKICEVCNDYHHDEQLLLCDYCDDAYHSFCLNPPLKEIPDEEEDWFCPVCVEQ
KYQMEKEKRSSGGRRSNSKVQKLLEQFNFKNQRDVAQKIQICGKCDDMILYMENEGVIEE
SEKCIKCNKMYHKECFSKKKESILCNSCQTLIKKQIPTDQKLIEDYFIRGQQESLGNKPY
EQDDKKSDKKNKATQDSKKMINENKKEKQDDESDDEILDVDALKEMENMRQTRGRRAKLL
QEKEQKEQKQSQKTDKSTKVEQQTRITRQRTQEKIDKLNDQYINDSNKTVNSVLAKKRKK
NDSTEFISNKTQINDDSLTQPLAINQKSSSSSSYYNDDCESNMSTTYSSTSNETQAKNTT
APINSKGGVKFLLPVPSSNPIVNLECKQSLIYALKAKNIQFCDDLCYTQQCPKQSNNANL
EPNLQVIDLANSIIFQKFKEMSRQGIYAPVVVEEDKIQGFIVRAMDDIKAKTLICEYVGE
VDYARNHIFNKNDSIMDLLRTARSKTSLVIVPDKKGNLARFLSGINNTSKKSMAKQNVHS
VRFNINGESRVILYAKRNIKKGELLYYDYNAGGFGEYPTQNFV


>TTHERM_00256950(gene)
ATGAATGATTATGAATCTTAATTAAAATAATTGATTATAAATCACTTTATAAGGATAAAG
CAATAGATAATTTATCAATAAAAAAATAAATCCAAAAAAATTAAATTAAGAGTCTTATTA
TTTAAAAAAAAGAGCAAATAACGAAAAAGTTATTTCGAAAAGAGAATAATAATTCTACGA
TAATACTAATAACCAAGTAAGAGTAAATTATAAATGGGACGTAAGAGAAGAGCTATGAAG
GCTAAATTGGATTAATTTTTGGAATACATTCATTCTTCGGAGGAAAAGATGACCTAGGAG
TAATATCTTTAACTCGTAAGAGAAAAGGTGAAGTAATTTTCAAAAAAAGATCTTAAGTAG
ATTCAAACAAATTACATTCTGGAAAAGATCTGTGAAGTATGTAATGACTATCATCACGAT
GAATAACTACTCCTCTGCGATTACTGTGATGATGCTTATCATTCTTTTTGCCTCGTAAGC
TCAAATAAATATTTCAATGCAAACTTTATCTCTCACTCTCTCTCATACATAAGTTATTTA
TATTTATTTAGTTTTCTTAATAATGTGAGGAAATAATCAAAAACTTTACTTTAGAAGTTA
AAATGATATAAAAAACACAAATATTTATGGATTAAAACACGATTTAATTCTCGTTTCTTA
TTGAAAAACTGAGTGAAGTGTTGGATTTTCGGAACTATGTAATAGTAAAAAGTATTTGGA
AATGTTATGGATAAAGAGAAACGATTTATAATATTTTGTTTGTAATTTATTTTAAAATAT
CGATTCATGATGTATAAAGCAAATCTTATGATGTTTAAATGAGAGAGAGAGTAGAAGTAG
ATAAGCAGCTTAAATTACTCAAAATCTTTTGATTTATAAACTAATAAATTTTATTTTAAA
TTTAGAACCCACCTCTTAAGGAAATTCCTGATGAAGAAGAAGATTGGTTTTGTCCAGTCT
GCGTTGAATAAAAATATTAAATGGAAAAAGAGAAAAGAAGCAGTGGAGGAAGGAGATCTA
ATTCAAAAGTACAAAAACTGCTCGAGTAGTTTAATTTTAAAAATTAAAGAGATGTTGCTT
AAAAGATACAGGTAAATTAACAAACAAATAAACTGTTTATTACATTTGAAGAGCCCTTCA
TTAGTCTATTAAAGCATGCTTCACTAAACAATTTTAAAGCGCTGTATCTTAAAATCAAGT
TTGCTCAAAATAATTCGTCTTTAATAAAAAAAATAATATTAACATGTAATGGAAATAAAT
AAAGAAAGATTTAATTTCTTTAGAATGATAAATTAAATGAATGAATGATTAATAAATAGA
TAAATAAATTAATAAATTTATATTACTTAAAGATTTTAAATCAATTTTTTAGAATAAAAA
AGCAAAAGAAGAAAATAAATTACAATGAATAACTCAAAAATTTAATTTTATCAATATTAT
TTTTCTTTCTCAAAATCTATCTAGAACTTTTATCATTGCTAAAAAGCTGAATTTCTACTA
ATAAATTAAATATACATACAAAACCATATTTTATAGAAGAGCAGTTATAGGATCTTTTTA
GATTGTATACCAATAAAAATCATTCTTTCATACATGGCAAATCTTTTTGATTTTGGACAG
ATAAAATGTTAGAAAATTATTTTATCAAGATTAATTATAGTTTTTACAGATAAATTTATA
AATTTCGCTTTCTATTTTAAATTTTTTTTATTTGAGCACAAAATCAACTAAAAAGATAAC
TCTAAATGCCTTTAAAAACTAAAAATTTTCTTATTCGATAAGTAGAATTAAATGTATATT
AAAATTATTATTATGAAAAAAAAAGATTTGTGGAAAATGTGATGATATGATTCTCTACAT
GGAGAACGAAGGTGTGATTGAAGAAAGCGAGAAATGTATCAAATGTAATAAAATGTATCA
CAAAGAGTGCTTCAGTAAAAAGAAAGAATCTATTTTATGCAATTCCTGTCAAACGCTTAT
CAAAAGTAATAAATTTAGTTTATTTAAAGACCTATCTATCTATAATTTTTTTTTCACTCA
AATTTCTTACACTTTAAACAATAAAAATTGAATGGAAGATAATAAATTACTTATAAAAAT
CATGTCTGATGAGAAAATAAAAACAATTCCTACTTCAAACACTGTCTTTGTTTTCTTTTA
CTTTACTAAAATTTTTATATTTCCTTCTTTTTCTACCCAAATTTAAAATTTTGTTTTTTA
TCTTAATCAAATTGAGCTTACATTTTTAATTAATTAAGACTAACAAACAAAAAGTAAAGG
AAACTAATCCTTTTGTATTTTTTTATTAAAGACACTCCATGTCTGAAGAACTCATTATAC
CATCAAATATTTATTGCTTCAACCATTCATTTTTATTTATAAATATTAAGATGGAAATTT
AAGAATGTTAAATTGTATTTTTGATTTCTTATAACTAAAATATCATTTAATTTATAAAGA
ATAAATCCCTACTGATTAGAAACTTATCGAGGATTACTTCATTAGAGGATAGCAAGAATC
TTTGGGTAATAAACCCTACGAATAGGATGATAAGAAGTCAGATAAAAAAAATAAAGCTAC
TCAGGATTCTAAGAAGATGATTAATGAAAATAAAAAGGAGAAGCAGGATGATGAAAGTGA
TGATGAGATACTTGATGTTGATGCTCTTAAAGAAATGGAAAATATGAGATAAACTCGTGG
AAGAAGAGCTAAATTGTTGTAAGAAAAAGAATAAAAAGAATAAAAGTAAAGTTAAAAAAC
AGATAAATCTACTAAAGTTGAATAACAAACTCGCATCACTAGATAAAGAACTCAAGAAAA
AATAGATAAATTAAATGATTAATATATTAACGACTCAAATAAAACAGTTAACTCTGTTTT
GGCTAAAAAAAGAAAGAAAAATGATTCTACTGAATTTATAAGTAATAAAACTTAAATTAA
CGATGACTCTTTGACTCAACCACTGGCTATTAACTAAAAATCTAGCAGCAGCAGTAGTTA
TTATAATGACGACTGCGAGTCTAATATGTCTACAACTTATTCATCAACAAGCAATGAAAC
ATAAGCTAAAAACACTACTGCACCTATAAATTCAAAAGGAGGAGTTAAATTCCTACTTCC
AGTTCCAAGCTCTAATCCAATTGTTAATTTAGAATGCAAGCAATCTTTAATCTATGCTTT
GAAAGCTAAAAACATCTAATTCTGCGACGATTTGTGCTACACTTAACAATGCCCTAAATA
AAGCAATAATGCTAATTTAGAACCAAATTTGTAAGTAATTGATCTTGCAAATAGCATTAT
ATTCTAAAAATTCAAAGAAATGAGCAGATAGGGGATTTATGCTCCTGTTGTAGTAGAAGA
AGATAAGATACAAGGATTTATAGTAAGAGCTATGGATGATATAAAGGCAAAGACTTTAAT
TTGCGAATATGTTGGTGAGGTCGATTATGCTAGAAACCACATCTTCAACAAAAACGACTC
TATTATGGATCTTTTGAGAACAGCTAGATCAAAAACATCATTAGTAATTGTTCCTGATAA
AAAAGGTAACCTTGCTAGATTCTTATCAGGAATTAATAATACTTCTAAAAAATCTATGGC
TAAACAGAATGTCCACAGTGTTAGATTCAACATTAATGGAGAATCAAGAGTAATTTTATA
TGCCAAAAGAAACATAAAAAAAGGAGAACTTCTATATTATGACTACAATGCAGGAGGATT
TGGAGAGTATCCAACATAAAATTTTGTATGA