Identifiers and Description

Gene Model Identifier

TTHERM_00203030

Standard Name

TWI9 (Tetrahymena Piwi 9)

Aliases

PreTt13775 | 17.m00382

Description

Argonaute-Piwi family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00203030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14909.19.997093137033517e-262piwi domain-containing protein
(808 aa)
OxytrichaContig13836.0.g229.9952060159684e-60Piwi domain
WormBaseWBGene000041784.000223764421475e-57locus:prg-1 status:Confirmed
UniProt:P90786 protein_id
:CAA98113.1
DictyBaseDDB_G02718702.0000236365077126e-43agnC on chromosome: 2 position
975850 to 979616
Stentor CoeruleusSteCoe_225081.603810890548638e-28

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_00203030(coding)
ATGAATTTAGTTCTTTCAAAGAGACCACAAAAGAGTTCTAGCTAAGAATTATAAAAGATA
TGCAAGGTCTCTCATGTTTTGACAAATATTTTTAATTTAAAAATCCAAGAATAGGTTTAA
TCTTAAATTGAAAAAAAGGAAGATAAAAATGATTAGTCTCATATAACTTGCTTTTAATAT
GATGTAGAATTTCAACCTGAAGTATCTGAAGACGACAGATAGCTAAGATATGCAATATTT
AAGAAAGCAAGGAAAGATATAGAAAGATTAATAGGCAAATTTAGCTTTTCTGGAAAATCT
TTTTACTCTCTGATAAAACCAATAAAAGAAAAAATGTATAAAGAATATTTGAATTTTGAC
AGTATTAAAATAGGTGAATAATCATATTCTATGAGAATTAAGTTTGTGAAGTAAATAGAA
GTTTAGAATGATGAAACCGTAGATTAATTTTCTAATAACTAAATTAACTAAATTCTAAAT
ATCACTTTCAAAGATATTTTGAGAGAAGAAAATTTTATTGAAATTGGCAAAAACTCTAAA
TTCTATAAGGAAAATGATATTAAGGAGAGATAGATCACTTTAAAAAATGGTTATGATATT
TAATTTCAAATTTATAAAGGTATAACATTTTAGATATATCAAACCCTTGAGAAATACTAA
ATAACTCTAGATTTTACAAGTAGAATAATGAGAAAAGATAATGCACTGAAATACTTAAAA
GAATTCAAAAATGGAATTATCGGCTAATCTGTAATTACTGCGTATAACAATTATTAAAGA
TATCAAATAACAGATTTAGATAGAACTAAAACTCCATAGAGTTAATTTTTATGGAATCAA
ACAAATAATTAAATTTCGTTTTTAGATTATTACTACTACAAATACAGGATCAAAATTGAA
CATATTAACCAACCTCTTTTAGTTTCATTTACAAAAAAGAGAGATCCTATTACTAAGCAA
TATCAGAAAAAAATTATTTATTTAGTCCCAGAGCTATGCCTGATGGCTGGGTTAAGCTCA
AATGAAAAAAGAAGCATCAACTAAATCACTCGTGGAATTTAACTCAATCCAAAGGAAAGA
TATGAATATACAATAGAAGAATCTTAATTACTTCGCAAATAATCATCTCATTAAGAAGTC
TATATAGATAGTATTCCAATATAAGCTAAAGCCTACATTTTAAATCCTCCTAATATCATA
CTAAAAAATAGTAAAATAATTCCTGAATAGGGAAAATTTGATTTTAAGGGCTAAATATTT
GAATGCAAAACTGATTTTACAGATTGGATAATCATTTACTCAAACAAAAATTAGACCCTA
GTAAACAAACTTTTAAAATTATTTCAAAATATCACTTAAAAACTGGAAATAAAGTATGAA
GATCCTAAAATAATTCATCATTCTTTAGTGAATCCTAAACATTTAATAGAAAAATTAGAT
AAATATTTTATTGAAACTGAGTATTTGCCTAGTTTTATTGTAACATTTGGAGACTTAAAT
ACAAATTTCTATTAGTAAATCAAACATTTCTTTTGTATTTTAGCTAATGTTGAATCTTAA
CATATTAGTCCTTAATCTTTAAAAAATAAAAATAAATATAAAATTTGCCTTAATATCGTC
CTATAAATATTATAAAAGACTGGCAACCAAATTTGGAATGTGGAAATGCCTATGTAAATC
ACATCGTAGACAATAAATACTATGATTGTTGGAATAGAAACTAGCCGAAATATAATCAAA
GGAAAATAAATTATTGCCGTTGTTTGCTCTATCAACAGAAACTTCTCAAGATATCTATCT
TAAGTTTACTTTAGAGAAAAAGGTTGCAAATAGCTTCATTAATTGTAGAAAATTATAAAA
GATGGAATACTAATTTACTAATAAATAGTAAAAAAATTACCAAAACAAATAATAATTTAC
AAATAAGGTTAAGGTGATGACCTAAAACAAAACAGTCATTTAACTGAAATAGAATCTATT
TAAAATATTGCAAGCAATATTAGTCCTACTTATTCTCCTAAATTTGCTTATTTTAATGTT
AACAAAAATGTTACATAAAAGATTTATCAATAAAATGAAGACAAAGCAATTTCCAATCCT
ATTCCAGGAACAGTATTTTCACACGAAACAAGTAAATCTTAAATTCATTTCTATCTAATA
GCTTAAAATTGTAGGAATGGTGTTAGCATTCCAACAAAATACAGCCTTTTATACAACTCA
ACTGATTTGAATTAAGAAACTTTTTGGTAGTTTACATACTATTAAACTTTCAACTACTAC
AATTAATAAGGTTCCATAAGAGTACCCGCAGCCTTGAAATACGCCGAGAAACTAGCAAAA
TATGTTTTTGATTATCTCTAAGATGACAACTTTGGTGATTTAAAAAAAAATTTATTTTAT
CTATGA


>TTHERM_00203030(protein)
MNLVLSKRPQKSSSQELQKICKVSHVLTNIFNLKIQEQVQSQIEKKEDKNDQSHITCFQY
DVEFQPEVSEDDRQLRYAIFKKARKDIERLIGKFSFSGKSFYSLIKPIKEKMYKEYLNFD
SIKIGEQSYSMRIKFVKQIEVQNDETVDQFSNNQINQILNITFKDILREENFIEIGKNSK
FYKENDIKERQITLKNGYDIQFQIYKGITFQIYQTLEKYQITLDFTSRIMRKDNALKYLK
EFKNGIIGQSVITAYNNYQRYQITDLDRTKTPQSQFLWNQTNNQISFLDYYYYKYRIKIE
HINQPLLVSFTKKRDPITKQYQKKIIYLVPELCLMAGLSSNEKRSINQITRGIQLNPKER
YEYTIEESQLLRKQSSHQEVYIDSIPIQAKAYILNPPNIILKNSKIIPEQGKFDFKGQIF
ECKTDFTDWIIIYSNKNQTLVNKLLKLFQNITQKLEIKYEDPKIIHHSLVNPKHLIEKLD
KYFIETEYLPSFIVTFGDLNTNFYQQIKHFFCILANVESQHISPQSLKNKNKYKICLNIV
LQILQKTGNQIWNVEMPMQITSQTINTMIVGIETSRNIIKGKQIIAVVCSINRNFSRYLS
QVYFREKGCKQLHQLQKIIKDGILIYQQIVKKLPKQIIIYKQGQGDDLKQNSHLTEIESI
QNIASNISPTYSPKFAYFNVNKNVTQKIYQQNEDKAISNPIPGTVFSHETSKSQIHFYLI
AQNCRNGVSIPTKYSLLYNSTDLNQETFWQFTYYQTFNYYNQQGSIRVPAALKYAEKLAK
YVFDYLQDDNFGDLKKNLFYL


>TTHERM_00203030(gene)
ATGAATTTAGTTCTTTCAAAGAGACCACAAAAGAGTTCTAGCTAAGAATTATAAAAGATA
TGCAAGGTCTCTCATGTTTTGACAAATATTTTTAATTTAAAAATCCAAGAATAGGTTTAA
TCTTAAATTGAAAAAAAGGAAGATAAAAATGATTAGTCTCATATAACTTGCTTTTAATAT
GATGTAGAATTTCAACCTGAAGTATCTGAAGACGACAGATAGCTAAGATATGCAATATTT
AAGAAAGCAAGGAAAGATATAGAAAGATTAATAGGCAAATTTAGCTTTTCTGGAAAATCT
TTTTACTCTCTGATAAAACCAATAAAAGAAAAAATGTATAAAGAATATTTGAATTTTGAC
AGTATTAAAATAGGTGAATAATCATATTCTATGAGAATTAAGTTTGTGAAGTAAATAGAA
GTTTAGAATGATGAAACCGTAGATTAATTTTCTAATAACTAAATTAACTAAATTCTAAAT
ATCACTTTCAAAGATATTTTGAGAGAAGAAAATTTTATTGAAATTGGCAAAAACTCTAAA
TTCTATAAGGAAAATGATATTAAGGAGAGATAGATCACTTTAAAAAATGGTTATGATATT
TAATTTCAAATTTATAAAGGTATAACATTTTAGATATATCAAACCCTTGAGAAATACTAA
ATAACTCTAGATTTTACAAGTAGAATAATGAGAAAAGATAATGCACTGAAATACTTAAAA
GAATTCAAAAATGGAATTATCGGCTAATCTGTAATTACTGCGTATAACAATTATTAAAGA
TATCAAATAACAGATTTAGATAGAACTAAAACTCCATAGAGTTAATTTTTATGGAATCAA
ACAAATAATTAAATTTCGTTTTTAGATTATTACTACTACAAATACAGGATCAAAATTGAA
CATATTAACCAACCTCTTTTAGTTTCATTTACAAAAAAGAGAGATCCTATTACTAAGCAA
TATCAGAAAAAAATTATTTATTTAGTCCCAGAGCTATGCCTGATGGCTGGGTTAAGCTCA
AATGAAAAAAGAAGCATCAACTAAATCACTCGTGGAATTTAACTCAATCCAAAGGAAAGA
TATGAATATACAATAGAAGAATCTTAATTACTTCGCAAATAATCATCTCATTAAGAAGTC
TATATAGATAGTATTCCAATATAAGCTAAAGCCTACATTTTAAATCCTCCTAATATCATA
CTAAAAAATAGTAAAATAATTCCTGAATAGGGAAAATTTGATTTTAAGGGCTAAATATTT
GAATGCAAAACTGATTTTACAGATTGGATAATCATTTACTCAAACAAAAATTAGACCCTA
GTAAACAAACTTTTAAAATTATTTCAAAATATCACTTAAAAACTGGAAATAAAGTATGAA
GATCCTAAAATAATTCATCATTCTTTAGTGAATCCTAAACATTTAATAGAAAAATTAGAT
AAATATTTTATTGAAACTGAGTATTTGCCTAGTTTTATTGTAACATTTGGAGACTTAAAT
ACAAATTTCTATTAGTAAATCAAACATTTCTTTTGTATTTTAGCTAATGTTGAATCTTAA
CATATTAGTCCTTAATCTTTAAAAAATAAAAATAAATATAAAATTTGCCTTAATATCGTC
CTATAAATATTATAAAAGACTGGCAACCAAATTTGGAATGTGGAAATGCCTATGTAAATC
ACATCGTAGACAATAAATACTATGATTGTTGGAATAGAAACTAGCCGAAATATAATCAAA
GGAAAATAAATTATTGCCGTTGTTTGCTCTATCAACAGAAACTTCTCAAGATATCTATCT
TAAGTTTACTTTAGAGAAAAAGGTTGCAAATAGCTTCATTAATTGTAGAAAATTATAAAA
GATGGAATACTAATTTACTAATAAATAGTAAAAAAATTACCAAAACAAATAATAATTTAC
AAATAAGGTTAAGGTGATGACCTAAAACAAAACAGTCATTTAACTGAAATAGAATCTATT
TAAAATATTGCAAGCAATATTAGTCCTACTTATTCTCCTAAATTTGCTTATTTTAATGTT
AACAAAAATGTTACATAAAAGATTTATCAATAAAATGAAGACAAAGCAATTTCCAATCCT
ATTCCAGGAACAGTATTTTCACACGAAACAAGTAAATCTTAAATTCATTTCTATCTAATA
GCTTAAAATTGTAGGAATGGTGTTAGCATTCCAACAAAATACAGCCTTTTATACAACTCA
ACTGATTTGAATTAAGAAACTTTTTGGTAGTTTACATACTATTAAACTTTCAACTACTAC
AATTAATAAGGTTCCATAAGAGTACCCGCAGCCTTGAAATACGCCGAGAAACTAGCAAAA
TATGTTTTTGATTATCTCTAAGATGACAACTTTGGTGATTTAAAAAAAAATTTATTTTAT
CTATGA