Identifiers and Description

Gene Model Identifier

TTHERM_00449120

Standard Name

TWI8 (Tetrahymena piWI )

Aliases

PreTt15430 | 52.m00208 | 3811.m00965 | DQ855965

Description

Argonaute/Piwi family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00449120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14988.19.997093137033517e-262piwi domain-containing protein
(847 aa)
OxytrichaContig1484.1.g656.998463833652622e-61Piwi domain
WormBaseWBGene000041789.999142814001536e-47locus:prg-1 status:Confirmed
UniProt:P90786 protein_id
:CAA98113.1
DictyBaseDDB_G02718703.998479955315009e-46agnC on chromosome: 2 position
975850 to 979616
Stentor CoeruleusSteCoe_50145.900090541597061e-29

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28053272: Farley BM, Collins K (2017) Transgenerational function of Tetrahymena Piwi protein Twi8p at distinctive noncoding RNA loci. RNA (New York, N.Y.) 23(4):530-545
  2. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_00449120(coding)
ATGTAATAAATAGAAACTAAAATATATCCGTTAACATTAGAAAGATATAAGAATTGGCAA
GTAAATAAATAAATTAATTAATATTTATTATAAAATAAAAATCTTTGTTAATAATAATTA
ATAGAAAAACAGCGAAAAAATTAAATGGATCAAGGAAGTTTAAGAGGTGAAAGTGAACAA
GGATCTTCGAGCCAGCAGAAGGAACAGAAACTTTAATTAGCAAGAAGACCCAAGTTAGAT
TACAATTAGCAGTCTAAGTCACTTATGCTCCTCACAAATTATTTAAAATTAGAATTAAAT
AAAAGTATTGAGGAAATCTACTTACTAAGAGTGGATTTTTATCCTAGAATTGAAGCTGAT
AATAGAGTTTTGAGAGATAAATTATTGAGTGTCAGCAGAGCTTAGTTAAAGGAATGTTTG
GGAGGGCATTATTTAATTAATGCTCAATAGATCTTTTCTGTCGAAAAGCCTAATTTTAAT
AAAGAAACATCAATCTCAATAACTTTTCAGAAAACTGATTACCAAGTTAACTTGAAAATC
ACAAAGGTATTTAGATTAGAGGATTTGAACAATGAAAATTAAAGAAAAAGCTAATTCCCT
CTCCTTTTCTTTAATGTCATGGTAAAGAATATACTCAAAGGATTAAATTTCTTTGAATTT
GGAAAGAATACAAAATATTTTGAACCCTCAGCTGAGTATCATTCAAAAATAGAAGGTACT
AATTTAATAGTTTACAAGGGATGGAATACTCCTTTTGAAAATTGTAGTGACGGCCTACTT
ATGAAGCTGGATATTTAACATAAAGTTGCCAGAAGAGAAAATGCTTTGAATTACATAAAT
TTAATTTATAAAAACAATAATGATGCATCTAAAGAGTAAAAGCGTAAGTTAGTTTGTGAA
AAGTTGCAAGGACAAACTGTAATGGCTAATTATGGCAACTTTAAGCAATTTAAAGTTCAT
GATGTAATTTTTGATAAAAATTGCAAAGAATTAAAAGTATCAGATCCTATTTTAGATCCT
AATTCCAAAGAATCATAGCTACCAATAGAACCACCTACTCTGCAATAACCTAATCCTGAT
TCAGATTTAACAATTTATGACTACTACTATAAAAAATATGGTCTTAAAATTAAATATGAT
AAATAACCTCTTCTTTTAGTTTATGAAAAGAAACTTAAGAGATTCCTCTATTTCGTTCCT
GAATTATGCTTACTCACAGGTATACCAGATGAGCTCAATGATTATTAAAAGAGAGAATTG
ATTACCTGTACCAAACAAAAACCATAAGAATTATACAATATGGTGACATAATTTATAGAT
AAAATAGTGAATGTCAATACCACAGAAGGTTAGCTAAATACATAATCTATATCTGAGCAG
CTAGGTATCAACTTCAGCAACCATCCTCATGTTATCTAAGCCAAACAAATTGCATATCCT
ACCATCACATTTGGTGGTCCTAAAAAGGATGCCCCACGCTAAACAATCGAAGATAACAGC
GCTTCTCAATTTAGTATGAAATACCCTGTTTATAGCTCAGGCAATCAGCTCTCCATAGCT
CTACTTCACTTTAAAGATTTCAACACAATGGATCTTTTTTAAAATTGGATTAAAATTTAG
AAGGAGCTAAGAATTGAAGTTAAAAAACCACAAGAATTCAATTTAGGTGATTTCAATAAT
AAGGCTATGTAAGAAATTGAGCATGTCATCCGTAGAGAAATCAAGAAAGAAAAATTTGAC
ATCGTTGCTATAGTTGCTCCTAATAAATTCTCTACAGTTCAAAATTATAGTAAAATAAAA
AAGTTGTGCACAATCACATAACAAATAAAATCCTAATACATTCGTTAGCAATCTCTAGAC
TCAAAGCAGTCTTACAATGTCTGCTCAGCAATTCTAAGTTAAATGGCTGCAAAATGCGGA
ACTACTTTGTGGGTGGTAAATCCTCCTAATGGTATACCAGACAACACAATGATTATTGGA
ACAAGTGTATAAAAGGTATTTATTAATGGACAACCTCAATTTGTTATTGGCTTTGTAGCT
TCTCAAGATAAAAATGTTAGTCGTTTCTATAGTCGTGCCACATTTTAAAAGTTAAATAAA
GATAATATTGAAAAAATCAGCACTTTTATTGTTGACGCCATTAAGTAGTACTTTGTTTAA
AATAAATTTGTACCTGAAAATATCATTTATTTGCGTGAAAACATTGCTGATTAAGGCATT
CAAAAATACTTGAGTACAGAAATAAAAGAAGTGCTTAAGTCATTTACAGTACTTTCCCCT
TAGTATAAACCAAAGCTCTGTGTAGTTTTGTTAGAATGTCGTCATGGTGTTCGTGTATTG
CATTAGCTAGGAGAAGGACCTAATAAAGAACTTGTAAATCCTCCTCCAGGCACTATCATT
GATTCTTCTATTACCAGCAAGTATCATTATGATTTCTATATGATATCCTAAAACGTAAAA
CAAGGAACTGCTACCCCAGTCCACTATAAAGTAATCTATGACACAACTGAATTCCCAGAA
GGGAGATTGTAAGAGTTGCTATACAGTTAATGCTTCAATTACGTTAACTGGAGTGGTAGT
ATAAAATATCCTGCCCAAATTTAATATGCAAAGAAACTAGCAAAAATGGTCGGAACTTTT
ATTTAAGAAGAAGTATCAGAAAAGCTTTTCAATTCAAGATTTTATATTTGA


>TTHERM_00449120(protein)
MQQIETKIYPLTLERYKNWQVNKQINQYLLQNKNLCQQQLIEKQRKNQMDQGSLRGESEQ
GSSSQQKEQKLQLARRPKLDYNQQSKSLMLLTNYLKLELNKSIEEIYLLRVDFYPRIEAD
NRVLRDKLLSVSRAQLKECLGGHYLINAQQIFSVEKPNFNKETSISITFQKTDYQVNLKI
TKVFRLEDLNNENQRKSQFPLLFFNVMVKNILKGLNFFEFGKNTKYFEPSAEYHSKIEGT
NLIVYKGWNTPFENCSDGLLMKLDIQHKVARRENALNYINLIYKNNNDASKEQKRKLVCE
KLQGQTVMANYGNFKQFKVHDVIFDKNCKELKVSDPILDPNSKESQLPIEPPTLQQPNPD
SDLTIYDYYYKKYGLKIKYDKQPLLLVYEKKLKRFLYFVPELCLLTGIPDELNDYQKREL
ITCTKQKPQELYNMVTQFIDKIVNVNTTEGQLNTQSISEQLGINFSNHPHVIQAKQIAYP
TITFGGPKKDAPRQTIEDNSASQFSMKYPVYSSGNQLSIALLHFKDFNTMDLFQNWIKIQ
KELRIEVKKPQEFNLGDFNNKAMQEIEHVIRREIKKEKFDIVAIVAPNKFSTVQNYSKIK
KLCTITQQIKSQYIRQQSLDSKQSYNVCSAILSQMAAKCGTTLWVVNPPNGIPDNTMIIG
TSVQKVFINGQPQFVIGFVASQDKNVSRFYSRATFQKLNKDNIEKISTFIVDAIKQYFVQ
NKFVPENIIYLRENIADQGIQKYLSTEIKEVLKSFTVLSPQYKPKLCVVLLECRHGVRVL
HQLGEGPNKELVNPPPGTIIDSSITSKYHYDFYMISQNVKQGTATPVHYKVIYDTTEFPE
GRLQELLYSQCFNYVNWSGSIKYPAQIQYAKKLAKMVGTFIQEEVSEKLFNSRFYI


>TTHERM_00449120(gene)
ATGTAATAAATAGAAACTAAAATATATCCGTTAACATTAGAAAGATATAAGAATTGGCAA
GTAAATAAATAAATTAATTAATATTTATTATAAAATAAAAATCTTTGTTAATAATAATTA
ATAGAAAAACAGCGAAAAAATTAAATGGATCAAGGAAGTTTAAGAGGTGAAAGTGAACAA
GGATCTTCGAGCCAGCAGAAGGAACAGAAAGTAATTGAATTTATATGCAATAAAGAATAG
TATAATTAAGCTATTGATGGATGACAGTCAATTTTTTGATGAGAAATAGATCCACTTCTT
ATCATACTATTATATCATTATTATATAATTGGCAATATTAATATGTAAAAAACCAATATT
TTCTTAAAATAATAAGCTTTAATTAGCAAGAAGACCCAAGTTAGATTACAATTAGCAGTC
TAAGTCACTTATGCTCCTCACAAATTATTTAAAATTAGAATTAAATAAAAGTATTGAGGA
AATCTACTTACTAAGAGTGGATTTTTATCCTAGAATTGAAGCTGATAATAGAGTTTTGAG
AGATAAATTATTGAGTGTCAGCAGAGCTTAGTTAAAGGAATGTTTGGGAGGGCATTATTT
AATTAATGCTCAATAGATCTTTTCTGTCGAAAAGCCTAATTTTAATAAAGAAACATCAAT
CTCAATAACTTTTCAGAAAACTGATTACCAAGTTAACTTGAAAATCACAAAGGTATTTAC
CAAATAACCATGCAATATTTTAGAATAAAATTGATTTTTCCCAGATTGTCTTACAAATAA
AATTTAAAGAAGCAGAAATTCCATAAAATGCAGAGTTAGATTTATAAATAACTTAAATAT
GAGACAAACACAGTCAGTCTCATAATTATGTGAAATAATTTTTTTATAAATAGTTTAGAT
TTTACTATTAGATTAGATCAAATGTGTGTGATACGTGGGGATTAAACTTTATTATAAACT
ACCAGCCTTCTTCAAAGCAAATAGTTTTTAATTATTTAATTTGTTAGTTGATTGTAAAAA
TACTAAAATTTAGTTAGAAAAAAATAAAGAAATCAATATTTAAAGCAGATTTTATTTTTA
CGAAATAAAGATAAAAAGGAATAAATAATAAAATAAATAAATTTAGCTATCAAAGTTAAT
TAAATCTGAATTACTAAAAATTTTTATTAAAATTAAATTTAATTTAAAAATTTTTACTAC
TATAAAAAATTTAGGTATTTAGATTAGAGGATTTGAACAATGAAAATTAAAGAAAAAGCT
AATTCCCTCTCCTTTTCTTTAATGTCATGGTAAAGAATATACTCAAAGGATTAAATTTCT
TTGAATTTGGAAAGAATACAAAATATTTTGAACCCTCAGCTGAGTATCATTCAAAAATAG
AAGGTACTAATTTAATAGTTTACAAGGGATGGAATACTCCTTTTGAAAATTGTAGTGACG
GCCTACTTATGAAGCTGGATATTTAACATAAAGTTGCCAGAAGAGAAAATGCTTTGAATT
ACATAAATTTAATTTATAAAAACAATAATGATGCATCTAAAGAGTAAAAGCGTAAGTTAG
TTTGTGAAAAGTTGCAAGGACAAACTGTAATGGCTAATTATGGCAACTTTAAGCAATTTA
AAGTTCATGATGTAATTTTTGATAAAAATTGCAAAGAATTAAAAGTATCAGATCCTATTT
TAGATCCTAATTCCAAAGAATCATAGCTACCAATAGAACCACCTACTCTGCAATAACCTA
ATCCTGATTCAGATTTAACAATTTATGACTACTACTATAAAAAATATGGTCTTAAAATTA
AATATGATAAATAACCTCTTCTTTTAGTTTATGAAAAGAAACTTAAGAGATTCCTCTATT
TCGTTCCTGAATTATGCTTACTCACAGGTATACCAGATGAGCTCAATGATTATTAAAAGA
GAGAATTGATTACCTGTACCAAACAAAAACCATAAGAATTATACAATATGGTGACATAAT
TTATAGATAAAATAGTGAATGTCAATACCACAGAAGGTTAGCTAAATACATAATCTATAT
CTGAGCAGCTAGGTATCAACTTCAGCAACCATCCTCATGTTATCTAAGCCAAACAAATTG
CATATCCTACCATCACATTTGGTGGTCCTAAAAAGGATGCCCCACGCTAAACAATCGAAG
ATAACAGCGCTTCTCAATTTAGTATGAAATACCCTGTTTATAGCTCAGGCAATCAGCTCT
CCATAGCTCTACTTCACTTTAAAGATTTCAACACAATGGATCTTTTTTAAGTAAAATTTA
TTAATTAAAGTTAAGCTTTCAATAAACAAATAGCTTTTTTATTTATATGATTGAATTTTT
TAATTAATTAATTAAAATGGAATTGATTGGCTAGTGTAAACAAACTAGATAAATAAATAT
AATATTTTCCTTTAATTTTTTACCAATTAATTCTTTTGTCTCAAAATTAAATAAAAAATT
ATATTTTGGCGTCTTATTTTTTCTTAATTAAATCTTACTAAAATCTTTTATTTTAAAAAT
GAAAGAATTGGATTAAAATTTAGAAGGAGCTAAGAATTGAAGTTAAAAAACCACAAGAAT
TCAATTTAGGTGATTTCAATAATAAGGCTATGTAAGAAATTGAGCATGTCATCCGTAGAG
AAATCAAGAAAGAAAAATTTGACATCGTTGCTATAGTTGCTCCTAATAAATTCTCTACAG
TTCAAAATTATAGTAAAATAAAAAAGTTGTGCACAATCACATAACAAATAAAATCCTAAT
ACATTCGTTAGCAATCTCTAGACTCAAAGCAGTCTTACAATGTCTGCTCAGCAATTCTAA
GTTAAATGGCTGCAAAATGCGGAACTACTTTGTGGGTGGTAAATCCTCCTAATGGTATAC
CAGACAACACAATGATTATTGGAACAAGTGTATAAAAGGTATTTATTAATGGACAACCTC
AATTTGTTATTGGCTTTGTAGCTTCTCAAGATAAAAATGTTAGTCGTTTCTATAGTCGTG
CCACATTTTAAAAGTTAAATAAAGATAATATTGAAAAAATCAGCACTTTTATTGTTGACG
CCATTAAGTAGTACTTTGTTTAAAATAAATTTGTACCTGAAAATATCATTTATTTGCGTG
AAAACATTGCTGATTAAGGCATTCAAAAATACTTGAGTACAGAAATAAAAGAAGTGCTTA
AGTCATTTACAGTACTTTCCCCTTAGTATAAACCAAAGCTCTGTGTAGTTTTGTTAGAAT
GTCGTCATGGTGTTCGTGTATTGCATTAGCTAGGAGAAGGACCTAATAAAGAACTTGTAA
ATCCTCCTCCAGGCACTATCATTGATTCTTCTATTACCAGCAAGTATCATTATGATTTCT
ATATGATATCCTAAAACGTAAAACAAGGAACTGCTACCCCAGTCCACTATAAAGTAATCT
ATGACACAACTGAATTCCCAGAAGGGAGATTGTAAGAGTTGCTATACAGTTAATGCTTCA
ATTACGTTAACTGGAGTGGTAGTATAAAATATCCTGCCCAAATTTAATATGCAAAGAAAC
TAGCAAAAATGGTCGGAACTTTTATTTAAGAAGAAGTATCAGAAAAGCTTTTCAATTCAA
GATTTTATATTTGA