Identifiers and Description

Gene Model Identifier

TTHERM_00503912

Standard Name

TWI5 (Tetrahymena piWI 5)

Aliases

3723.m00723

Description

twi2p; piwi-like Twi9p protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.5%

TetraMine Data

TTHERM_00503912

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14909.19.997093137033517e-262piwi domain-containing protein
(808 aa)
OxytrichaContig16116.0.g203.9981372112117256e-92Piwi domain
DictyBaseDDB_G02762998.000800527229359e-71agnA on chromosome: 2 position
6579134 to 6582276
WormBaseWBGene000041784.998816730869543e-67locus:prg-1 status:Confirmed
UniProt:P90786 protein_id
:CAA98113.1
Stentor CoeruleusSteCoe_18461.1089390193121365e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_00503912(protein)
MLQQLPKRPPKSSSQEISKICRNIKLLTNLFTMQVEAPQSSDSDGPQGCVYKLLCYQYDV
EFSPNIAEDNRNLRYKIFKEARRDIEQIIGKFSFSGKSLFSMKNLSIVKLNKIKNIDAIN
VDGQKYSILLRFTKSFEVNDESAQNKDKTSINFKKGNQVTQLLNIILKSIMRDEKFQEIG
KNSKFYDVNSKSDIIIKSRDGSTSALEAYKGFTFNVTPTQDRLYLMVDYCSRIIRKETAL
EYLKNNNNQLSGLSVITKYNNYQTYLIDRVDDKKTPSSTFLNQKTKTQISFAQYYKERYN
IQIRDMKQPLLVHKRKYREPNTNIQKIEEVYLIPELCNMTGMTDEQRENFQAMKEVATHT
KLTPNERYQNSVKNCKFLSNKTSSSGIKIDEKSNLIDAVQLRAPKVTLGGNKTANTERGN
FDMRAPTLDKIEFKDWSLICNKKDDQSADNFIDTLKKASQTFGITVNDPCFLAQRDWNAN
NWIKTLDEDFSNNGLPQFVLSFGQANSGLYSGLKRFLTSEVGIESQHVNPRSLQKNGMSV
ASKIALQIASKLGRRIWQVETPTGIDKHTMIIGIETSMKKINKQQVIGVVASIDKDFTKY
FSDVEIRKENDTTFPTLSKIVTKAIQAYVKNTKSVPAEVIVYRQGLGEGQIQQSCNFEIK
AIQNGFINFKKDYNPRLAFFQVNRKIGQKFYQQPQGDKSEVSNPASGTIVASQVVQNNFE
FFMAAQNCNSGVCTPTKYTCLYNNTNLKEDQIWQLTYYQTFNYYNWQGPVRVPAAMKYAE
KLAKFVSDTIQESANENLANSLFYL


>TTHERM_00503912(coding)
ATGCTTTAATAGTTACCTAAAAGGCCACCTAAATCTTCATCCTAAGAGATTAGCAAAATA
TGCAGAAATATTAAACTACTGACAAATCTGTTTACTATGTAAGTAGAAGCCCCCTAGTCT
TCTGATTCTGATGGACCTCAAGGTTGTGTCTACAAACTTCTTTGTTATCAATATGATGTT
GAATTCTCCCCTAATATTGCTGAGGACAACAGAAACCTCAGATACAAAATCTTTAAAGAA
GCTCGCAGAGATATTGAGCAAATCATAGGAAAATTCTCCTTTTCAGGAAAATCTCTATTC
TCAATGAAAAATCTTAGCATAGTTAAGCTTAACAAAATCAAGAATATTGATGCGATCAAT
GTTGATGGATAAAAATACTCTATCCTTTTGAGGTTCACAAAAAGCTTTGAAGTGAATGAT
GAATCTGCTTAAAATAAAGACAAGACTTCTATAAACTTCAAAAAAGGTAATCAAGTCACT
TAGTTACTCAATATCATCTTAAAGTCTATTATGCGTGATGAGAAATTTTAGGAAATTGGA
AAAAATTCTAAGTTCTATGATGTTAACTCTAAGAGTGATATTATAATCAAAAGTAGAGAT
GGATCTACTAGTGCCCTCGAAGCCTACAAAGGATTCACTTTCAATGTCACTCCAACCTAA
GACAGACTTTACTTAATGGTTGATTACTGCAGTAGAATTATCAGAAAAGAAACTGCATTA
GAATACTTAAAGAATAACAACAATTAATTGTCTGGTCTTTCAGTTATTACCAAATACAAT
AATTATCAAACTTACTTAATCGACAGAGTAGATGACAAAAAAACTCCTAGTTCTACTTTC
CTTAACTAAAAAACTAAAACCTAAATTAGTTTCGCATAGTACTACAAGGAGCGTTATAAT
ATCTAAATCAGAGACATGAAATAACCCTTACTTGTTCATAAAAGAAAATACAGAGAGCCT
AATACTAACATCTAAAAGATTGAAGAAGTTTATTTAATTCCTGAATTATGCAATATGACA
GGAATGACAGACGAATAACGTGAGAATTTCCAAGCAATGAAGGAAGTTGCTACTCATACA
AAATTAACTCCTAATGAAAGATATCAAAATTCTGTTAAAAATTGCAAATTTTTAAGTAAC
AAAACAAGTTCCAGTGGAATTAAAATTGATGAAAAAAGCAATTTGATAGATGCTGTTTAA
TTAAGAGCTCCTAAAGTCACTTTAGGTGGTAATAAGACAGCTAATACAGAAAGAGGTAAT
TTTGACATGAGAGCTCCTACCTTAGATAAAATTGAGTTTAAAGATTGGTCTCTTATATGT
AACAAAAAAGATGACTAAAGTGCAGATAATTTTATAGACACTCTTAAGAAGGCTTCCTAG
ACATTTGGAATTACTGTCAACGATCCTTGCTTTTTGGCCTAGAGAGACTGGAATGCTAAT
AACTGGATTAAAACTCTCGATGAAGACTTTTCCAATAATGGTTTACCTCAATTTGTTTTG
AGTTTCGGTCAAGCCAATAGTGGTTTATACTCTGGTTTAAAGAGATTTTTAACTTCAGAA
GTAGGTATAGAATCCTAGCATGTTAATCCAAGATCACTCCAAAAGAACGGAATGAGTGTT
GCTTCAAAAATTGCTCTGTAAATTGCCTCTAAACTAGGTAGAAGAATCTGGTAAGTTGAA
ACCCCAACTGGAATTGATAAACACACCATGATTATTGGTATAGAGACCAGTATGAAGAAG
ATCAATAAATAATAGGTGATTGGTGTTGTTGCTTCTATCGACAAAGACTTTACCAAATAC
TTTTCTGATGTTGAAATAAGGAAAGAAAATGATACTACTTTCCCTACTCTCTCTAAGATT
GTTACCAAAGCCATATAGGCTTATGTTAAAAATACCAAAAGTGTTCCTGCTGAAGTGATT
GTTTACAGATAAGGACTTGGTGAAGGTCAAATTCAATAGAGTTGTAACTTTGAAATTAAG
GCCATTTAGAATGGTTTTATCAACTTTAAGAAAGATTACAATCCACGCTTAGCCTTTTTC
TAGGTTAACAGAAAAATTGGCCAAAAGTTCTATCAATAACCTTAAGGTGATAAATCAGAA
GTTTCAAATCCTGCTTCAGGTACTATTGTGGCCTCTTAAGTTGTTTAGAACAACTTTGAA
TTCTTCATGGCTGCATAAAACTGCAATTCTGGTGTTTGTACACCTACTAAGTACACCTGT
TTGTACAATAACACTAACTTAAAAGAGGATCAAATCTGGTAATTAACTTACTATCAAACT
TTCAACTACTACAACTGGTAAGGACCTGTAAGAGTACCTGCTGCTATGAAGTACGCAGAA
AAACTTGCTAAGTTTGTCAGTGACACTATCCAAGAATCTGCCAATGAAAACTTGGCAAAC
AGTCTTTTCTATTTGTGA


>TTHERM_00503912(gene)
ATGCTTTAATAGTTACCTAAAAGGCCACCTAAATCTTCATCCTAAGAGATTAGCAAAATA
TGCAGAAATATTAAACTACTGACAAATCTGTTTACTATGTAAGTAGAAGCCCCCTAGTCT
TCTGATTCTGATGGACCTCAAGGTTGTGTCTACAAACTTCTTTGTTATCAATATGATGTT
GAATTCTCCCCTAATATTGCTGAGGACAACAGAAACCTCAGATACAAAATCTTTAAAGAA
GCTCGCAGAGATATTGAGCAAATCATAGGAAAATTCTCCTTTTCAGGAAAATCTCTATTC
TCAATGAAAAATCTTAGCATAGTTAAGCTTAACAAAATCAAGAATATTGATGCGATCAAT
GTTGATGGATAAAAATACTCTATCCTTTTGAGGTTCACAAAAAGCTTTGAAGTGAATGAT
GAATCTGCTTAAAATAAAGACAAGACTTCTATAAACTTCAAAAAAGGTAATCAAGTCACT
TAGTTACTCAATATCATCTTAAAGTCTATTATGCGTGATGAGAAATTTTAGGAAATTGGA
AAAAATTCTAAGTTCTATGATGTTAACTCTAAGAGTGATATTATAATCAAAAGTAGAGAT
GGATCTACTAGTGCCCTCGAAGCCTACAAAGGATTCACTTTCAATGTCACTCCAACCTAA
GACAGACTTTACTTAATGGTTGATTACTGCAGTAGAATTATCAGAAAAGAAACTGCATTA
GAATACTTAAAGAATAACAACAATTAATTGTCTGGTCTTTCAGTTATTACCAAATACAAT
AATTATCAAACTTACTTAATCGACAGAGTAGATGACAAAAAAACTCCTAGTTCTACTTTC
CTTAACTAAAAAACTAAAACCTAAATTAGTTTCGCATAGTACTACAAGGAGCGTTATAAT
ATCTAAATCAGAGACATGAAATAACCCTTACTTGTTCATAAAAGAAAATACAGAGAGCCT
AATACTAACATCTAAAAGATTGAAGAAGTTTATTTAATTCCTGAATTATGCAATATGACA
GGAATGACAGACGAATAACGTGAGAATTTCCAAGCAATGAAGGAAGTTGCTACTCATACA
AAATTAACTCCTAATGAAAGATATCAAAATTCTGTTAAAAATTGCAAATTTTTAAGTAAC
AAAACAAGTTCCAGTGGAATTAAAATTGATGAAAAAAGCAATTTGATAGATGCTGTTTAA
TTAAGAGCTCCTAAAGTCACTTTAGGTGGTAATAAGACAGCTAATACAGAAAGAGGTAAT
TTTGACATGAGAGCTCCTACCTTAGATAAAATTGAGTTTAAAGATTGGTCTCTTATATGT
AACAAAAAAGATGACTAAAGTGCAGATAATTTTATAGACACTCTTAAGAAGGCTTCCTAG
ACATTTGGAATTACTGTCAACGATCCTTGCTTTTTGGCCTAGAGAGACTGGAATGCTAAT
AACTGGATTAAAACTCTCGATGAAGACTTTTCCAATAATGGTTTACCTCAATTTGTTTTG
AGTTTCGGTCAAGCCAATAGTGGTTTATACTCTGGTTTAAAGAGATTTTTAACTTCAGAA
GTAGGTATAGAATCCTAGCATGTTAATCCAAGATCACTCCAAAAGAACGGAATGAGTGTT
GCTTCAAAAATTGCTCTGTAAATTGCCTCTAAACTAGGTAGAAGAATCTGGTAAGTTGAA
ACCCCAACTGGAATTGATAAACACACCATGATTATTGGTATAGAGACCAGTATGAAGAAG
ATCAATAAATAATAGGTGATTGGTGTTGTTGCTTCTATCGACAAAGACTTTACCAAATAC
TTTTCTGATGTTGAAATAAGGAAAGAAAATGATACTACTTTCCCTACTCTCTCTAAGATT
GTTACCAAAGCCATATAGGCTTATGTTAAAAATACCAAAAGTGTTCCTGCTGAAGTGATT
GTTTACAGATAAGGACTTGGTGAAGGTCAAATTCAATAGAGTTGTAACTTTGAAATTAAG
GCCATTTAGAATGGTTTTATCAACTTTAAGAAAGATTACAATCCACGCTTAGCCTTTTTC
TAGGTTAACAGAAAAATTGGCCAAAAGTTCTATCAATAACCTTAAGGTGATAAATCAGAA
GTTTCAAATCCTGCTTCAGGTACTATTGTGGCCTCTTAAGTTGTTTAGAACAACTTTGAA
TTCTTCATGGCTGCATAAAACTGCAATTCTGGTGTTTGTACACCTACTAAGTACACCTGT
TTGTACAATAACACTAACTTAAAAGAGGATCAAATCTGGTAATTAACTTACTATCAAACT
TTCAACTACTACAACTGGTAAGGACCTGTAAGAGTACCTGCTGCTATGAAGTACGCAGAA
AAACTTGCTAAGTTTGTCAGTGACACTATCCAAGAATCTGCCAATGAAAACTTGGCAAAC
AGTCTTTTCTATTTGTGA