Identifiers and Description

Gene Model Identifier

TTHERM_00506900

Standard Name

TWI2 (Tetrahymena piWI 2 )

Aliases

PreTt10673 | 64.m00153 | 3723.m00018

Description

PAZ and Piwi Domain (PPD) protein; similar to the Piwi/Argonaute proteins

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.8%

TetraMine Data

TTHERM_00506900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14909.19.997093137033517e-262piwi domain-containing protein
(808 aa)
OxytrichaContig16116.0.g201.999022616705709e-90Piwi domain
DictyBaseDDB_G02762994.997593565024277e-70agnA on chromosome: 2 position
6579134 to 6582276
WormBaseWBGene000041781.9997677415930956e-65locus:prg-1 status:Confirmed
UniProt:P90786 protein_id
:CAA98113.1
Stentor CoeruleusSteCoe_14131.5007857627073948e-41

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32
  2. Ref:12297043: Mochizuki K, Fine NA, Fujisawa T, Gorovsky MA (2002) Analysis of a piwi-related gene implicates small RNAs in genome rearrangement in tetrahymena. Cell 110(6):689-99

Sequences

>TTHERM_00506900(coding)
ATGCTTTAATAGTTGCCTAAAAGACCTCCTAAATCTTCAGCTTAAGATATCAGCAAAATA
TGCAAAAATATTAAGCTGCTCACTAACATGTTTACAATGTAAGTAGAAGCCCCCTAGTCT
TCTGATTCTGATGAACCTCAAGGATTTGTGAACAAAGTTCTTTGCCATTAGTATGATGTT
GAATTCTCTCCTAGTATTGCTGAGGACAACAGAAATCTAAGATACAAAATCTTTAAAGAA
GCACGCAGGAACATTGAATAAATCATTGGAAAATTCTCCTTTTCAGGAAAGTCTCTATTC
TCAATGAGAAATCTTAGCAAAGAAAAGATTAATAAAATCAAGAATATTGATGCAATCAAT
GTTGATGGACAAAAATTCTCTATCCTATTGAGGTTCACTAAAACTTTTGAAGTGAATGAT
GAATCTGCTTAAAATTTAGACAAGACCTCTCCAAACTTCAAAAAAGGTAATCAAGTCACT
TAGTTGCTCAATATCATCTTAAAGTCTATCATGCGTGATGAGAAGTTTTAGGAAATTGGA
AAGAATTCTAAGTTCTATAATGTTAACTCTAGGAATGAAATCGTAATCAAAGGCAGAGAC
GGAAATACTAGTGCCCTCGAAGCATATAAGGGATTCACTTTCAATGTCACTCCAACCTAA
GACAAACTTTACTTAATGGTTGACTACTGCAGCAGAATTATCAGAAAAGAAACTGCTTTA
GAATACTTAAAGAATAACAACAATTAATTGTCTGGTCTTTCAGTAATTACCAAATACAAT
AATTACCAAACTTACTTAATCGACAGAGTAGATGGCCAAAAAACACCTAGTTCTACTTTC
CTTAACTCCAAAACTAACACCTAAATTAGCTTCGCATAATACTATAAGGAGCGTTATAAT
ATTTAAATCAGAGACATGAGATAGCCCTTACTTGTTCACAAAAGAAAATATAGAGAGGCT
AATACTAACATCTAAAAGGTTGAGGAAGTTTATTTAATTCCTGAAATATGCAATATGACA
GGAATGACAGACGAATAACGTGAGAATTTCCAAGCAATGAAGGAAGTTGCTACTCACACC
AAGTTAACTCCTTAAGAAAGATATCAAAATTCTGTTAACAATTGCAGATTTTTAAGCAGC
AAAACAAGCTCCAGTGGAATTAGAATTGATGAAAGAAGCAATTTAATTGACGCTGTTTAA
TTAAGAGCTCCTAAAGTCACTCTAGGAGGTAATAAGACTGCTAATACTGATAGAGGTAAT
TTTGACATGAGAGCTCCTACCTTAGATAAAATCGAGTTTAAGGATTGGACTCTTATTTAT
AACCAAAAAGATGAGAGATCTGTGGATGGTTTCATAGACACTCTTAAGAAGGCTTCCTAG
ACATATGGAATTACTGTCAACGACCCTTTCTTTTTCGCCTAAAGAGATTGGAATGCTAAT
AGTTGGATTAAATCTCTAGATGAGGACTTTTCTAAGAATGACTTACCTTAATTTGTTTTG
AGTTTTGGTCAAGCTTAAAGCGGTTTATATTCTGGTCTGAAGAAATTTTTAACTTCAGAA
GCAGGAATTGAATCCTAGCATGTTAATCCAAGATCCCTCCAAAAGAACGGAATGAGTGTT
GCTTCAAAAATTGCTCTGCAAATTGCCTCTAAACTTGGTAGAAGAATCTGGTAAGTTGAA
ACCCCAACTGGAATTGATAAAAATACCATGATTATAGGTATTGAGACCAGCATGAAAAAG
ATTAAATAGTAGTAGGTTGTAGGTGTTGTTGCTTCCATCGACAAAGACTTTACCAAATAC
TTTTCTGATGTTGAAATTAGGAAAGACAATGATACTACTCTCCCTACTCTCTCTAAGATT
GTTACCAAAGCCATATAAGCTTATGTTAAAAATACCAAAAGTGTTCCTGCTGAAGTGATT
GTTTACAGATAAGGACTTGGTGAAGGTTAAATTCAATAGAGTTGTAACCTTGAAATTAAG
GCCATTTAGAATGGTTTTAGTAACTTCAAGAGCGATTTCAATCCACGTTTAGCCTTTTTC
TAGGTTAATAGAAAAATTGGACAAAAGTTCTATTAATCACCTTAAGGTGACAAAGGTGAA
GTCTCAAATCCTGCTTCAGGTACTATTGTAGCCTCTTAAGTTGTTTAGAACAACTTCGAA
TTCTTCATGGCTGCATAAAACTGCAATTCTGGTGTTTGTACACCCACTAAATACACCTGT
TTGTACAATAACACTAACTTAAAAGAAGATTAAATCTGGTAATTAACTTACTATCAAACT
TTCAATTACTATAACTGGCAAGGACCTGTAAGAGTACCTGCCGCTATGAAGTACGCAGAA
AAACTTGCTAAATTCGTAAGTGACACTATCTAAGAAGCTGCCAACGAAAACTTGACTAAC
AGTCTTTTCTACTTGTGA


>TTHERM_00506900(protein)
MLQQLPKRPPKSSAQDISKICKNIKLLTNMFTMQVEAPQSSDSDEPQGFVNKVLCHQYDV
EFSPSIAEDNRNLRYKIFKEARRNIEQIIGKFSFSGKSLFSMRNLSKEKINKIKNIDAIN
VDGQKFSILLRFTKTFEVNDESAQNLDKTSPNFKKGNQVTQLLNIILKSIMRDEKFQEIG
KNSKFYNVNSRNEIVIKGRDGNTSALEAYKGFTFNVTPTQDKLYLMVDYCSRIIRKETAL
EYLKNNNNQLSGLSVITKYNNYQTYLIDRVDGQKTPSSTFLNSKTNTQISFAQYYKERYN
IQIRDMRQPLLVHKRKYREANTNIQKVEEVYLIPEICNMTGMTDEQRENFQAMKEVATHT
KLTPQERYQNSVNNCRFLSSKTSSSGIRIDERSNLIDAVQLRAPKVTLGGNKTANTDRGN
FDMRAPTLDKIEFKDWTLIYNQKDERSVDGFIDTLKKASQTYGITVNDPFFFAQRDWNAN
SWIKSLDEDFSKNDLPQFVLSFGQAQSGLYSGLKKFLTSEAGIESQHVNPRSLQKNGMSV
ASKIALQIASKLGRRIWQVETPTGIDKNTMIIGIETSMKKIKQQQVVGVVASIDKDFTKY
FSDVEIRKDNDTTLPTLSKIVTKAIQAYVKNTKSVPAEVIVYRQGLGEGQIQQSCNLEIK
AIQNGFSNFKSDFNPRLAFFQVNRKIGQKFYQSPQGDKGEVSNPASGTIVASQVVQNNFE
FFMAAQNCNSGVCTPTKYTCLYNNTNLKEDQIWQLTYYQTFNYYNWQGPVRVPAAMKYAE
KLAKFVSDTIQEAANENLTNSLFYL


>TTHERM_00506900(gene)
ATGCTTTAATAGTTGCCTAAAAGACCTCCTAAATCTTCAGCTTAAGATATCAGCAAAATA
TGCAAAAATATTAAGCTGCTCACTAACATGTTTACAATGTAAGTAGAAGCCCCCTAGTCT
TCTGATTCTGATGAACCTCAAGGATTTGTGAACAAAGTTCTTTGCCATTAGTATGATGTT
GAATTCTCTCCTAGTATTGCTGAGGACAACAGAAATCTAAGATACAAAATCTTTAAAGAA
GCACGCAGGAACATTGAATAAATCATTGGAAAATTCTCCTTTTCAGGAAAGTCTCTATTC
TCAATGAGAAATCTTAGCAAAGAAAAGATTAATAAAATCAAGAATATTGATGCAATCAAT
GTTGATGGACAAAAATTCTCTATCCTATTGAGGTTCACTAAAACTTTTGAAGTGAATGAT
GAATCTGCTTAAAATTTAGACAAGACCTCTCCAAACTTCAAAAAAGGTAATCAAGTCACT
TAGTTGCTCAATATCATCTTAAAGTCTATCATGCGTGATGAGAAGTTTTAGGAAATTGGA
AAGAATTCTAAGTTCTATAATGTTAACTCTAGGAATGAAATCGTAATCAAAGGCAGAGAC
GGAAATACTAGTGCCCTCGAAGCATATAAGGGATTCACTTTCAATGTCACTCCAACCTAA
GACAAACTTTACTTAATGGTTGACTACTGCAGCAGAATTATCAGAAAAGAAACTGCTTTA
GAATACTTAAAGAATAACAACAATTAATTGTCTGGTCTTTCAGTAATTACCAAATACAAT
AATTACCAAACTTACTTAATCGACAGAGTAGATGGCCAAAAAACACCTAGTTCTACTTTC
CTTAACTCCAAAACTAACACCTAAATTAGCTTCGCATAATACTATAAGGAGCGTTATAAT
ATTTAAATCAGAGACATGAGATAGCCCTTACTTGTTCACAAAAGAAAATATAGAGAGGCT
AATACTAACATCTAAAAGGTTGAGGAAGTTTATTTAATTCCTGAAATATGCAATATGACA
GGAATGACAGACGAATAACGTGAGAATTTCCAAGCAATGAAGGAAGTTGCTACTCACACC
AAGTTAACTCCTTAAGAAAGATATCAAAATTCTGTTAACAATTGCAGATTTTTAAGCAGC
AAAACAAGCTCCAGTGGAATTAGAATTGATGAAAGAAGCAATTTAATTGACGCTGTTTAA
TTAAGAGCTCCTAAAGTCACTCTAGGAGGTAATAAGACTGCTAATACTGATAGAGGTAAT
TTTGACATGAGAGCTCCTACCTTAGATAAAATCGAGTTTAAGGATTGGACTCTTATTTAT
AACCAAAAAGATGAGAGATCTGTGGATGGTTTCATAGACACTCTTAAGAAGGCTTCCTAG
ACATATGGAATTACTGTCAACGACCCTTTCTTTTTCGCCTAAAGAGATTGGAATGCTAAT
AGTTGGATTAAATCTCTAGATGAGGACTTTTCTAAGAATGACTTACCTTAATTTGTTTTG
AGTTTTGGTCAAGCTTAAAGCGGTTTATATTCTGGTCTGAAGAAATTTTTAACTTCAGAA
GCAGGAATTGAATCCTAGCATGTTAATCCAAGATCCCTCCAAAAGAACGGAATGAGTGTT
GCTTCAAAAATTGCTCTGCAAATTGCCTCTAAACTTGGTAGAAGAATCTGGTAAGTTGAA
ACCCCAACTGGAATTGATAAAAATACCATGATTATAGGTATTGAGACCAGCATGAAAAAG
ATTAAATAGTAGTAGGTTGTAGGTGTTGTTGCTTCCATCGACAAAGACTTTACCAAATAC
TTTTCTGATGTTGAAATTAGGAAAGACAATGATACTACTCTCCCTACTCTCTCTAAGATT
GTTACCAAAGCCATATAAGCTTATGTTAAAAATACCAAAAGTGTTCCTGCTGAAGTGATT
GTTTACAGATAAGGACTTGGTGAAGGTTAAATTCAATAGAGTTGTAACCTTGAAATTAAG
GCCATTTAGAATGGTTTTAGTAACTTCAAGAGCGATTTCAATCCACGTTTAGCCTTTTTC
TAGGTTAATAGAAAAATTGGACAAAAGTTCTATTAATCACCTTAAGGTGACAAAGGTGAA
GTCTCAAATCCTGCTTCAGGTACTATTGTAGCCTCTTAAGTTGTTTAGAACAACTTCGAA
TTCTTCATGGCTGCATAAAACTGCAATTCTGGTGTTTGTACACCCACTAAATACACCTGT
TTGTACAATAACACTAACTTAAAAGAAGATTAAATCTGGTAATTAACTTACTATCAAACT
TTCAATTACTATAACTGGCAAGGACCTGTAAGAGTACCTGCCGCTATGAAGTACGCAGAA
AAACTTGCTAAATTCGTAAGTGACACTATCTAAGAAGCTGCCAACGAAAACTTGACTAAC
AGTCTTTTCTACTTGTGA