Identifiers and Description

Gene Model Identifier

TTHERM_00653810

Standard Name

TWI12 (Tetrahymena piWI)

Aliases

PreTt12868 | 95.m00114 | 3825.m02522

Description

Argonaute/Piwi family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00653810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00722.19.997093137033517e-262PAZ domain-containing protein
(881 aa)
OxytrichaContig276.0.g876.002718307283067e-26Piwi domain
Stentor CoeruleusSteCoe_154800.0000000001026187963170189
WormBaseWBGene000041790.000000000500206551404915locus:prg-2 status:Partially
_confirmed UniProt:Q17567
protein_id:CCD62443.1
DictyBaseDDB_G02893670.000000019990673443141236agnE on chromosome: 5 position
2710003 to 2713807

General Information

Paragraph NoGene NameParagraph Text
59TWI12Gene Model error: The open reading frame for the major protein product starts at an upstream in-frame ATG, adding 17 amino acids to the N-terminus of the predicted protein (Couvillion et al., Mol. Cell, 2012).

Associated Literature

  1. Ref:23084833: Couvillion MT, Bounova G, Purdom E, Speed TP, Collins K (2012) A Tetrahymena Piwi bound to mature tRNA 3' fragments activates the exonuclease Xrn2 for RNA processing in the nucleus. Molecular cell 48(4):509-20
  2. Ref:21106669: Couvillion MT, Sachidanandam R, Collins K (2010) A growth-essential Tetrahymena Piwi protein carries tRNA fragment cargo. Genes & development 24(24):2742-7
  3. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_00653810(coding)
ATGGATCAGCAATAGATTTATAAGTTATTTTTGTATTCCAATCTTTTGAAGATGGATATA
CAATCACCCATTTATAAGCAAGATGTTTAGATAACTCCTGAAAAATTTGCTTCTAGTTCA
GATAGAGAAGCTGTATTCTTGGGAGTGCGCAAAATATTACATATCTCTCATGATATGGAC
AATTGTATTTTTTTAAAGAAAAACAATATTCACCTTAGTGAAGAAGTTTAAGAGAATCCA
TAAGCACAATGGGTTTGCTATAGCAGTAAATAAATGTACTAAGGTTAGGATAGTATGAGT
GTTTTAGGATACTAGGTTAGTATTAAATAGATTTAACAAAATGGTAGTCCTGCATTTATA
ACTACCAACAAAGAGAGATAGCTTGTTTTAAATTATATTGCAAGAGAAATTTTTTCAAAA
CTAAATTATCATTAATACTAAAAAGGGTTTTTCAATCCTATTGACCCCCCTAATGCTGCC
CTTAGTAAAGATAAAACTGTTGTTTATCAAACTTACTCATGGAATGGGCTAAGACCTAAG
GCAATTGAATTTAGAGGTAAAGTTTATCTGGAAATTGAAACCACTCCTGTGCGCTTCTTG
CGTATGAATTTGTTCTAAATTATTAACAAACTTGAAGATAAAAAAATTCCAAGAGAAGAA
ATAAGCAATTTTTTGGTAGGACGCACTGTTAAGACATCTTATTTCTCCACTAATCTATAT
TATGAAATTTTAGAAATAGATTTTAATATGACTCCTGACAGTAAATTTGTCGTAAAATAA
AACTAAATTTAAGATGAAGGAGATATGATTGCAGAAAAAGGTGATGAAGAACTCTCTTAT
TATTCTTATGTTAAGAACAAATATAGAATTAACATTAGAGACAGAGTTTAGCCAATGATT
AGAGTTCGCCCTCTTCACAAAGGCTTTAAATCCGAATTTCATAGTAGTTAAGATTAGCAA
ATGTACCTCATTCCAAGTCTTTGCAATCTTTTTGGATAGATTTCTCAAAAAGGTTTTATT
GACGATAATGTTGGAACAGAATTCTACTTTGAACCTTATGATGTATATGATTATACTAAT
TAAATTACTAGATTTTTAAAAAATAGCTCTGAAGCTTAAAGTTTGCTAAATGGATGGTAA
ATTAAAATAGGAGAAGAGTTCGAACAGATTGGTTTTAACTACCTCAAATTATCTCCTTTA
TAACTCAAAGTTAATAATGTCAATGAGTCTTTTTCTCCTAACGACTTATGCTGTAAGCGT
TTATGTAACGAATTCGATGGATATTATAAATAGCTATTCTGTTCTGATGGAGCTTTCACT
AAATTCACTGAAGTTAATAGATGGGTTATTTTTGTCCACTCTAGCGATTCACCATTAGTT
GAAGCTCTGGTCTCTTCGATCTCTCAGTTTAAGCTATACTACAATTACCCTATTTCAGAA
CCAAAATATTATAAGATAGATGATTTAAATATTGAAACATGGACAAGCACCTTTAATACT
GCCTTATCTGAGAGTCCTACTACATTTGCATTGATTATTATGAACAGTGAATTAGAGCAC
TATCACTTTTATAAAACTTGTAAGCAAGCAATTACAGTGGATAAAGGCATTTGCTGTTCA
CTTATTAAGGCTTCTACTCTCTAGCAATATGTTCCTACTTAATAATATCCATAAATACCC
CCAGGAAACTCGATTGAAGCTTTTGCAAGCCGTTTCTTATCATAAATGCAAGCTAAGCTT
GGTGAGTCACCTTGGCTTATGTAGGAATTACCATACAATTAAAATCCTTGCACAATGATA
GGGTTTAGTGTATTACGCCAACGTAATGCTAGAAAAATTATAGTAGCAGGAGCTGCTTCT
ATTAATAAATAGTATAGCAAATATCTCCCTGATTATAGAGTTATTAGTGAAGTTTCAACT
AAAATCAAGGAAGATGGTACTTTAGAGATAGTAGAGCTTTCAGAACAAGAAATAAACAAT
TCAATAACTAATAGCATGAAAGATATTCTTCAAGGATTTTTAAGTTAGTTTGCAACAACT
CACAAAATAAATCCAACCTGGGTTATTATTATTCGTGACGGTATATTTATTTAAAATGCA
CAAAATGAAAAAGATGCTATATTCTCTATGATGAGCACTCGCCGTTCCTAAAGTGAAAAC
AAATCATTCCACCTTTTGTTTGCAACATCTCGTTATCAAACTAGCTTCCGTACTTATAAT
TTCTATGGATCATCAGAACTTAATGCTAACACATAAAACGTATCTTCTCCAGGAACAGGT
GCTATAGTTGAAAAGTAGTTGAACAAGCGCGAATTTTATCTTTATACATAAAAAATAGTT
AAAAACTGTCCATTTTCTGTGCTATACAATGTATTACATATAGATAAATTTATTGGATTA
GACGAGCATTCTTTGTTAGCTGATTTCTAAGACTTGGTATATAACACTTATGTGCTAAAT
TATACATACCACACAAAGACAACTTCACCAGCTTGTGTACAAAATGCTTATAAATTAGCA
GAATTTGTTAAAATGTTTGTAACACCTGCAGGGTCTTAATAAAATACAATAGATCTATCA
AACTTGAGAGTGCTGTGCTCAAATTATAAGCTCTTCTTCATTTGA


>TTHERM_00653810(protein)
MDQQQIYKLFLYSNLLKMDIQSPIYKQDVQITPEKFASSSDREAVFLGVRKILHISHDMD
NCIFLKKNNIHLSEEVQENPQAQWVCYSSKQMYQGQDSMSVLGYQVSIKQIQQNGSPAFI
TTNKERQLVLNYIAREIFSKLNYHQYQKGFFNPIDPPNAALSKDKTVVYQTYSWNGLRPK
AIEFRGKVYLEIETTPVRFLRMNLFQIINKLEDKKIPREEISNFLVGRTVKTSYFSTNLY
YEILEIDFNMTPDSKFVVKQNQIQDEGDMIAEKGDEELSYYSYVKNKYRINIRDRVQPMI
RVRPLHKGFKSEFHSSQDQQMYLIPSLCNLFGQISQKGFIDDNVGTEFYFEPYDVYDYTN
QITRFLKNSSEAQSLLNGWQIKIGEEFEQIGFNYLKLSPLQLKVNNVNESFSPNDLCCKR
LCNEFDGYYKQLFCSDGAFTKFTEVNRWVIFVHSSDSPLVEALVSSISQFKLYYNYPISE
PKYYKIDDLNIETWTSTFNTALSESPTTFALIIMNSELEHYHFYKTCKQAITVDKGICCS
LIKASTLQQYVPTQQYPQIPPGNSIEAFASRFLSQMQAKLGESPWLMQELPYNQNPCTMI
GFSVLRQRNARKIIVAGAASINKQYSKYLPDYRVISEVSTKIKEDGTLEIVELSEQEINN
SITNSMKDILQGFLSQFATTHKINPTWVIIIRDGIFIQNAQNEKDAIFSMMSTRRSQSEN
KSFHLLFATSRYQTSFRTYNFYGSSELNANTQNVSSPGTGAIVEKQLNKREFYLYTQKIV
KNCPFSVLYNVLHIDKFIGLDEHSLLADFQDLVYNTYVLNYTYHTKTTSPACVQNAYKLA
EFVKMFVTPAGSQQNTIDLSNLRVLCSNYKLFFI


>TTHERM_00653810(gene)
AAATATATATTGTTCAAAGATATTAAAAAATTATTTAATTAGTTAAGAAAGCAAAATTAG
TAGACTAATAAATTATAAAATCAAGATAAAGCAATATTTATTTTACATAAATGGATCAGC
AATAGATTTATAAGTTATTTTTGTATTCCAATCTTTTGAAGATGGATATACAATCACCCA
TTTATAAGCAAGATGTTTAGATAACTCCTGAAAAATTTGCTTCTAGTTCAGATAGAGAAG
CTGTATTCTTGGGAGTGCGCAAAATATTACATATCTCTCATGATATGGACAATTGTATTT
TTTTAAAGAAAAACAATATTCACCTTAGTGAAGAAGTTTAAGAGAATCCATAAGCACAAT
GGGTTTGCTATAGCAGTAAATAAATGTACTAAGGTTAGGATAGTATGAGTGTTTTAGGAT
ACTAGGTTAGTATTAAATAGATTTAACAAAATGGTAGTCCTGCATTTATAACTACCAACA
AAGAGAGATAGCTTGTTTTAAATTATATTGCAAGAGAAATTTTTTCAAAACTAAATTATC
ATTAATACTAAAAAGGGTTTTTCAATCCTATTGACCCCCCTAATGCTGCCCTTAGTAAAG
ATAAAACTGTTGTTTATCAAACTTACTCATGGAATGGGCTAAGACCTAAGGCAATTGAAT
TTAGAGGTAAAGTTTATCTGGAAATTGAAACCACTCCTGTGCGCTTCTTGCGTATGAATT
TGTTCTAAATTATTAACAAACTTGAAGATAAAAAAATTCCAAGAGAAGAAATAAGCAATT
TTTTGGTAGGACGCACTGTTAAGACATCTTATTTCTCCACTAATCTATATTATGAAATTT
TAGAAATAGATTTTAATATGACTCCTGACAGTAAATTTGTCGTAAAATAAAACTAAATTT
AAGATGAAGGAGATATGATTGCAGAAAAAGGTGATGAAGAACTCTCTTATTATTCTTATG
TTAAGAACAAATATAGAATTAACATTAGAGACAGAGTTTAGCCAATGATTAGAGTTCGCC
CTCTTCACAAAGGCTTTAAATCCGAATTTCATAGTAGTTAAGATTAGCAAATGTACCTCA
TTCCAAGTCTTTGCAATCTTTTTGGATAGATTTCTCAAAAAGGTTTTATTGACGATAATG
TTGGAACAGAATTCTACTTTGAACCTTATGATGTATATGATTATACTAATTAAATTACTA
GATTTTTAAAAAATAGCTCTGAAGCTTAAAGTTTGCTAAATGGATGGTAAATTAAAATAG
GAGAAGAGTTCGAACAGATTGGTTTTAACTACCTCAAATTATCTCCTTTATAACTCAAAG
TTAATAATGTCAATGAGTCTTTTTCTCCTAACGACTTATGCTGTAAGCGTTTATGTAACG
AATTCGATGGATATTATAAATAGCTATTCTGTTCTGATGGAGCTTTCACTAAATTCACTG
AAGTTAATAGATGGGTTATTTTTGTCCACTCTAGCGATTCACCATTAGTTGAAGCTCTGG
TCTCTTCGATCTCTCAGTTTAAGCTATACTACAATTACCCTATTTCAGAACCAAAATATT
ATAAGATAGATGATTTAAATATTGAAACATGGACAAGCACCTTTAATACTGCCTTATCTG
AGAGTCCTACTACATTTGCATTGATTATTATGAACAGTGAATTAGAGCACTATCACTTTT
ATAAAACTTGTAAGCAAGCAATTACAGTGGATAAAGGCATTTGCTGTTCACTTATTAAGG
CTTCTACTCTCTAGCAATATGTTCCTACTTAATAATATCCATAAATACCCCCAGGAAACT
CGATTGAAGCTTTTGCAAGCCGTTTCTTATCATAAATGCAAGCTAAGCTTGGTGAGTCAC
CTTGGCTTATGTAGGAATTACCATACAATTAAAATCCTTGCACAATGATAGGGTTTAGTG
TATTACGCCAACGTAATGCTAGAAAAATTATAGTAGCAGGAGCTGCTTCTATTAATAAAT
AGTATAGCAAATATCTCCCTGATTATAGAGTTATTAGTGAAGTTTCAACTAAAATCAAGG
AAGATGGTACTTTAGAGATAGTAGAGCTTTCAGAACAAGAAATAAACAATTCAATAACTA
ATAGCATGAAAGATATTCTTCAAGGATTTTTAAGTTAGTTTGCAACAACTCACAAAATAA
ATCCAACCTGGGTTATTATTATTCGTGACGGTATATTTATTTAAAATGCACAAAATGAAA
AAGATGCTATATTCTCTATGATGAGCACTCGCCGTTCCTAAAGTGAAAACAAATCATTCC
ACCTTTTGTTTGCAACATCTCGTTATCAAACTAGCTTCCGTACTTATAATTTCTATGGAT
CATCAGAACTTAATGCTAACACATAAAACGTATCTTCTCCAGGAACAGGTGCTATAGTTG
AAAAGTAGTTGAACAAGCGCGAATTTTATCTTTATACATAAAAAATAGTTAAAAACTGTC
CATTTTCTGTGCTATACAATGTATTACATATAGATAAATTTATTGGATTAGACGAGCATT
CTTTGTTAGCTGATTTCTAAGACTTGGTATATAACACTTATGTGCTAAATTATACATACC
ACACAAAGACAACTTCACCAGCTTGTGTACAAAATGCTTATAAATTAGCAGAATTTGTTA
AAATGTTTGTAACACCTGCAGGGTCTTAATAAAATACAATAGATCTATCAAACTTGAGAG
TGCTGTGCTCAAATTATAAGCTCTTCTTCATTTGATTAATTTTTAAAAAATATAAAACCT
TACTAAATAAATAAATACATAGTTAATAATTAGCGAATTT