Identifiers and Description

Gene Model Identifier

TTHERM_00144830

Standard Name

TWI11 (Tetrahymena piWI)

Aliases

PreTt26691 | 11.m00388 | 3702.m00110

Description

Argonaute/Piwi family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00144830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04784.19.997093137033517e-262piwi domain-containing protein
(799 aa)
OxytrichaContig1484.1.g658.002927718340724e-80Piwi domain
DictyBaseDDB_G02718702.0008536325002377e-42agnC on chromosome: 2 position
975850 to 979616
WormBaseWBGene000041781.9994920269952867e-34locus:prg-1 status:Confirmed
UniProt:P90786 protein_id
:CAA98113.1
Stentor CoeruleusSteCoe_6875.380186160021138e-32

General Information

Paragraph NoGene NameParagraph Text
108TWI1,
TWI11
Maternally-expressed Twi1p is loaded with Early-scnRNAs expressed from the MIC at early conjugation stages while zygotically-expressed Twi1p and Twi11p are loaded with Late-scnRNAs expressed from the new MAC at late conjugation stages (Noto et al. 2015).

Associated Literature

  1. Ref:27892853: Hamilton EP, Kapusta A, Huvos PE, Bidwell SL, Zafar N, Tang H, Hadjithomas M, Krishnakumar V, Badger JH, Caler EV, Russ C, Zeng Q, Fan L, Levin JZ, Shea T, Young SK, Hegarty R, Daza R, Gujja S, Wortman JR, Birren BW, Nusbaum C, Thomas J, Carey CM, Pritham EJ, Feschotte C, Noto T, Mochizuki K, Papazyan R, Taverna SD, Dear PH, Cassidy-Hanley DM, Xiong J, Miao W, Orias E, Coyne RS (2016) Structure of the germline genome of Tetrahymena thermophila and relationship to the massivel
  2. Ref:26095658: Noto T, Kataoka K, Suhren JH, Hayashi A, Woolcock KJ, Gorovsky MA, Mochizuki K (2015) Small-RNA-Mediated Genome-wide trans-Recognition Network in Tetrahymena DNA Elimination. Molecular cell 59(2):229-42
  3. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_00144830(coding)
ATGAGTTTTAACGATAATAGTAATACTTTGGTTACTAATCATTACAAAATTAAAATTAAT
AATATAAAGATTAATTGCTATGAATTTTAGACTTAGCCTCCTATTGATCCTCTTTTGCTT
AACCGTAAGTCAAGATACATCTCAAGAGTTTTCAACAAAAAGATAAAAGAAATATTTAGT
ACCTTTATTATTGGGTCTTAACTTATTTACTCTCCTATTGATTTGCATAATAAAGTCAGT
CTTGGAACCTTTGATTTTGTATCCCCTAAGACTGATGGGTGTGAGTCCTTCACTTAAGAG
CTTGAAGTTTTCTTAGTAAAGAAAAAAGATATTGTTGGATAATAGCTTGAAGAGGAAAAT
AAAGAACTTCAAAATATATTGGGATAGCTAATGAGAAACTTCTAAAATAACACTAAAGGG
TTTTAATAGCTTGGTGCTACTAAGAGGTTTGCTATGAATGTTATAAAAAATATCTCTAAT
GGCCTTGAAGCAGTTCTCGGAGTTGAAACTTTCTTCAAATTTAGTCCTCAAACAGGATTT
TAACTTTCAGTAGATTACTGTATCAAAGTTATTAACAACACATCTGTTTATGATTTCTTA
AAAAAATCTATGTCTTAAGGAGCAGATAGTATCCAAGAAAAAATGTAAAACTGTGTAGTT
ATTAGTAATTATGGAGATAAAAAATTGTACAAGGTTAATGGAGTAGCGTTTGATTTAAAT
CCTAATTCTTTCTTTGAAATGAGGGATCCTAATGAATCTACTGGTAAAAAGAAAATATCA
TTCGTTTAATACTATGAGCTCGTCCATAACATCAGAATTAGAGATAATAGATAGCCTCTT
CTTATAGTTGAAAAGAAAAGAAGATAAAATAAAAGAGCTAATTAAGAAGGAAAACCATAA
TAAGAAACTCCTAAAATCTATTTAATACCAGAGTTATGCTAAATGACTGGCATTCCTGAT
GAACTTCAAAATGACTTTATGCTCAAGAAAGCTATAACACAAGTTTCCTAGCCCAAACCT
TAAGAGAGATCTTAGCACTGTGGAAATTATGTCTCAGCTCTAATACACTAAAACTAAAAG
GCTCTAAGTGAATGGGGCATTTAACTAAGCTAAAATGACCCTGTTAAAGCTCGTTATCAA
GTTATCCAACCAGGATGTATTCTTATGAATTAAAATAGAGAAATTAACATTTATGGAGAA
AAATAACTAGATAGAAAAATTTAAGATAGAATGTACCAGCCTTGCTACCTCAAGAAGTGG
TGTGCCATTTGTCACAAATCTGATCAATAATTGGCTGGCTAGTTCATGTCAACACTGAAG
AATAGAATGCAAGCTCATGGGATAGGATATAATGAACCTAATTATTTTACTGTTGAAGGT
TAATCACAAGATGAACTCAAAAGGCTTATCGATTCATTCCCACCTGATGTTGATTTTATT
GTATTTATATTGCAAGGAGCCAAAGGAAAAGGCAAAAATTATTAGTACCTAAAATCTTTT
TTGTTAAAAGAAAAACCTATTCCTAGCTAGATGATTCTTTAAGGTACTATCAAGAGCAGT
AAAGATGGTTGCTAAGTTATTTGTAACAAGATATGCAATCAAATATGTATTAAAGTTGGA
GGAATACCTTACATCATCAAAGATCTTCCATTTAGTAATCTTCCTACTATGCTTGTTGGT
ATAGATTACATCCGCAAAGAAAACTAAAAATCAGTTTATTCATTTGTTGCTTCAGTTGAC
AGTACATTCTGTAAATTTTTTTCAGGTGCTTAACTTTTAGACGCTTAAGACTAAAATAAC
AAATTTGTTGACAAGCTTTTGCAAGCAAGTCTTACTTAATTTAAATAAAAAAATGGAATA
CTGCCTTAACGTGTTATAATTTATAGATAAGCTGCTAACAATATATTGAACGAGCCTCTA
AAGGAAGAAATTGCAATCATGAAAAAATGCCTATCAGAAATGGAAATGTCTTAATGCAAG
ATCCACATAGTTGGTGTTAACAGTAGTGATAAGACTAAATTTTTCAATGAAGATTACTCT
AATCCAGCTTAAGGAACTGTCATTAGTTAAGATGTAGTATCATCGTAAGGAGATTTCTTC
TTGGTGTCTCAAAGATCTATGCAAGGAACTGCATAACCTATGATGTACAAAGAGATTTAC
AGTGATTATGAAGGTATGGAATTAGAATAAATAAGGACTTAACTTCATACCTTGACCTAT
AGGATGAGTTATCTTTTCTACAATTTCACTGGAGCAATCAAGATACCAAGCATCTTGAAG
TATGCTGAATAGTAAACTAAATTCATGAAAAACAACTTTGAGAACTTGAATAAGATGGAC
CCTCAAACACTCCTCAGCTAGAAGATGTGTGATAAGAATTCTACATTCTATATTTGA


>TTHERM_00144830(protein)
MSFNDNSNTLVTNHYKIKINNIKINCYEFQTQPPIDPLLLNRKSRYISRVFNKKIKEIFS
TFIIGSQLIYSPIDLHNKVSLGTFDFVSPKTDGCESFTQELEVFLVKKKDIVGQQLEEEN
KELQNILGQLMRNFQNNTKGFQQLGATKRFAMNVIKNISNGLEAVLGVETFFKFSPQTGF
QLSVDYCIKVINNTSVYDFLKKSMSQGADSIQEKMQNCVVISNYGDKKLYKVNGVAFDLN
PNSFFEMRDPNESTGKKKISFVQYYELVHNIRIRDNRQPLLIVEKKRRQNKRANQEGKPQ
QETPKIYLIPELCQMTGIPDELQNDFMLKKAITQVSQPKPQERSQHCGNYVSALIHQNQK
ALSEWGIQLSQNDPVKARYQVIQPGCILMNQNREINIYGEKQLDRKIQDRMYQPCYLKKW
CAICHKSDQQLAGQFMSTLKNRMQAHGIGYNEPNYFTVEGQSQDELKRLIDSFPPDVDFI
VFILQGAKGKGKNYQYLKSFLLKEKPIPSQMILQGTIKSSKDGCQVICNKICNQICIKVG
GIPYIIKDLPFSNLPTMLVGIDYIRKENQKSVYSFVASVDSTFCKFFSGAQLLDAQDQNN
KFVDKLLQASLTQFKQKNGILPQRVIIYRQAANNILNEPLKEEIAIMKKCLSEMEMSQCK
IHIVGVNSSDKTKFFNEDYSNPAQGTVISQDVVSSQGDFFLVSQRSMQGTAQPMMYKEIY
SDYEGMELEQIRTQLHTLTYRMSYLFYNFTGAIKIPSILKYAEQQTKFMKNNFENLNKMD
PQTLLSQKMCDKNSTFYI


>TTHERM_00144830(gene)
AATAAAAAACTATTTCATAAAAATTGTTTTAATCTTAAGTAAAAAATAATCTCTAAATTC
GATATGAGTTTTAACGATAATAGTAATACTTTGGTTACTAATCATTACAAAATTAAAATT
AATAATATAAAGATTAATTGCTATGAATTTTAGACTTAGCCTCCTATTGATCCTCTTTTG
CTTAACCGTAAGTCAAGATACATCTCAAGAGTTTTCAACAAAAAGATAAAAGAAATATTT
AGTACCTTTATTATTGGGTCTTAACTTATTTACTCTCCTATTGATTTGCATAATAAAGTC
AGTCTTGGAACCTTTGATTTTGTATCCCCTAAGACTGATGGGTGTGAGTCCTTCACTTAA
GAGCTTGAAGTTTTCTTAGTAAAGAAAAAAGATATTGTTGGATAATAGCTTGAAGAGGAA
AATAAAGAACTTCAAAATATATTGGGATAGCTAATGAGAAACTTCTAAAATAACACTAAA
GGGTTTTAATAGCTTGGTGCTACTAAGAGGTTTGCTATGAATGTTATAAAAAATATCTCT
AATGGCCTTGAAGCAGTTCTCGGAGTTGAAACTTTCTTCAAATTTAGTCCTCAAACAGGA
TTTTAACTTTCAGTAGATTACTGTATCAAAGTTATTAACAACACATCTGTTTATGATTTC
TTAAAAAAATCTATGTCTTAAGGAGCAGATAGTATCCAAGAAAAAATGTAAAACTGTGTA
ATCAATTATTATTTCTTGATTTTATTTTTTACATTAATTAAAAATTTTATTTAAACAGGT
AGTTATTAGTAATTATGGAGATAAAAAATTGTACAAGGTTAATGGAGTAGCGTTTGATTT
AAATCCTAATTCTTTCTTTGAAATGAGGGATCCTAATGAATCTACTGGTAAAAAGAAAAT
ATCATTCGTTTAATACTATGAGCTCGTCCATAACATCAGAATTAGAGATAATAGATAGCC
TCTTCTTATAGTTGAAAAGAAAAGAAGATAAAATAAAAGAGCTAATTAAGAAGGAAAACC
ATAATAAGAAACTCCTAAAATCTATTTAATACCAGAGTTATGCTAAATGACTGGCATTCC
TGATGAACTTCAAAATGACTTTATGCTCAAGAAAGCTATAACACAAGTTTCCTAGCCCAA
ACCTTAAGAGAGATCTTAGCACTGTGGAAATTATGTCTCAGCTCTAATACACTAAAACTA
AAAGGCTCTAAGTGAATGGGGCATTTAACTAAGCTAAAATGACCCTGTTAAAGCTCGTTA
TCAAGTTATCCAACCAGGATGTATTCTTATGAATTAAAATAGAGAAATTAACATTTATGG
AGAAAAATAACTAGATAGAAAAATTTAAGATAGAATGTACCAGCCTTGCTACCTCAAGAA
GGTATTTTTTATTTTTAATTTTTTTTAATAATTTTTCAAACACAAGAAAATTTTTTATTT
ATTTTTTACATTTTATTTATAATAATATTATTTAAAAGTGGTGTGCCATTTGTCACAAAT
CTGATCAATAATTGGCTGGCTAGTTCATGTCAACACTGAAGAATAGAATGCAAGCTCATG
GGATAGGATATAATGAACCTAATTATTTTACTGTTGAAGGTTAATCACAAGATGAACTCA
AAAGGCTTATCGATTCATTCCCACCTGATGTTGATTTTATTGTATTTATATTGCAAGGAG
CCAAAGGAAAAGGCAAAAATTATTAGTACCTAAAATCTTTTTTGTTAAAAGAAAAACCTA
TTCCTAGCTAGATGATTCTTTAAGGTACTATCAAGAGCAGTAAAGATGGTTGCTAAGTTA
TTTGTAACAAGATATGCAATCAAATATGTATTAAAGTTGGAGGAATACCTTACATCATCA
AAGATCTTCCATTTAGTAATCTTCCTACTATGCTTGTTGGTATAGATTACATCCGCAAAG
AAAACTAAAAATCAGTTTATTCATTTGTAAAATTTTTTTTTTCATCTATTCATTAAAAGA
AAAAAATAAATTATTAATTAATTACTTTAACTTTACTAATTAAGGTTGCTTCAGTTGACA
GTACATTCTGTAAATTTTTTTCAGGTGCTTAACTTTTAGACGCTTAAGACTAAAATAACA
AATTTGTTGACAAGCTTTTGCAAGCAAGTCTTACTTAATTTAAATAAAAAAATGGAATAC
TGCCTTAACGTGTTATAATTTATAGATAAGCTGCTAACAATATATTGAACGAGCCTCTAA
AGGAAGAAATTGCAATCATGAAAAAATGCCTATCAGAAATGGAAATGTCTTAATGCAAGA
TCCACATAGTTGGTGTTAACAGTAGTGATAAGACTAAATTTTTCAATGAAGATTACTCTA
ATCCAGCTTAAGGAACTGTCATTAGTTAAGATGTAGTATCATCGTAAGGAGATTTCTTCT
TGGTGTCTCAAAGATCTATGCAAGGAACTGCATAACCTATGATGTACAAAGAGATTTACA
GTGATTATGAAGGTATGGAATTAGAATAAATAAGGACTTAACTTCATACCTTGACCTATA
GGATGAGTTATCTTTTCTACAATTTCACTGGAGCAATCAAGATACCAAGCATCTTGAAGT
ATGCTGAATAGTAAACTAAATTCATGAAAAACAACTTTGAGAACTTGAATAAGATGGACC
CTCAAACACTCCTCAGCTAGAAGATGTGTGATAAGAATTCTACATTCTATATTTGA