Identifiers and Description

Gene Model Identifier

TTHERM_00077240

Standard Name

TTU3 (Tetrahymena Thermophila polyUbiquitin )

Aliases

PreTt10070 | 5.m00421 | 3828.m01331

Description

Polyubiquitin; gene encodes five identical, tandem Ub units; full-length transcript levels increase under hyperthermic stress conditions

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.5%

TetraMine Data

TTHERM_00077240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_242950
WormBaseWBGene000067279.997093137033517e-262locus:ubq-1 status:Confirmed
UniProt:G8JY83 protein_id
:CCD68780.1
DictyBaseDDB_G02823699.997093137033517e-262ubqG on chromosome: 3 position
5878544 to 5879689
OxytrichaContig8023.0.g949.997093137033517e-262Ubiquitin family
SGDYLL039C9.997093137033517e-262UBI4 Ubiquitin, becomes conjug
ated to proteins, marking them
for selective degradation via
the ubiquitin-26S proteasome
system; essential for the cell
ular stress response; encoded
as a polyubiquitin precursor c
omprised of 5 head-to-tail rep
eats
Tetrahymena borealisEI9_14651.13.998941839720987e-159ubiquitin family protein (231
aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:8982086: Guerreiro P, Rodrigues-Pousada C (1996) Characterization of a polyubiquitin gene in T. thermophila and of ubiquitin gene expression during sexual reproduction and under stress conditions. Gene 182(1-2):183-8

Sequences

>TTHERM_00077240(coding)
ATGCAAATCTTCGTTAAGACCCTTACTGGTAAAACCATTACTTTAGACGTTGAAGCCTCC
GACACTATTGAAAACGTCAAGGCTAAGATTCAAGACAAGGAAGGTATCCCTCCTGATCAA
TAAAGACTTATCTTCGCTGGTAAGCAATTAGAAGACGGCAGAACCCTTTCTGACTACAAC
ATTCAAAAGGAATCAACCCTCCACTTGGTTTTAAGATTAAGAGGTGGTATGCAAATTTTC
GTCAAGACCTTGACTGGTAAGACCATCACTCTTGACGTTGAAGCCTCTGACACTATTGAA
AACGTCAAGGCTAAGATCCAAGACAAGGAAGGTATCCCCCCTGATCAATAAAGACTTATC
TTCGCTGGTAAGCAATTAGAAGACGGCAGAACCCTTTCTGACTACAACATCCAAAAGGAA
TCTACCCTCCACTTAGTCCTCAGATTAAGAGGTGGTATGTAAATCTTCGTCAAGACCTTA
ACTGGCAAGACCATCACTCTTGATGTTGAAGCCTCCGACACCATTGAAAATGTCAAGGCT
AAGATCTAAGACAAGGAAGGTATCCCCCCTGATCAATAAAGACTTATCTTCGCTGGTAAG
CAATTAGAAGACGGCAGAACCCTTTCTGACTACAACATCCAAAAGGAATCTACTCTCCAC
TTAGTCCTTAGATTGAGAGGTGGTATGTAAATCTTCGTCAAGACCTTAACTGGCAAGACC
ATCACTCTTGATGTCGAAGCTTCTGACACCATTGAAAACGTCAAGGCTAAGATCCAAGAC
AAGGAAGGTATCCCCCCTGATCAATAAAGACTTATCTTCGCTGGTAAGCAATTAGAAGAC
GGCAGAACCCTTTCTGACTACAACATTCAAAAGGAATCAACCCTCCACTTGGTTTTAAGA
TTAAGAGGTGGTATGCAAATTTTCGTCAAGACCTTGACTGGTAAGACCATCACTCTTGAC
GTTGAAGCCTCTGACACTATTGAAAACGTCAAGGCTAAGATCCAAGACAAGGAAGGTATC
CCCCCTGATCAATAAAGACTTATCTTCGCTGGTAAGCAATTAGAAGACGGCAGAACCCTT
TCTGACTACAACATCCAAAAGGAATCTACCCTCCACTTAGTCCTCAGATTAAGAGGTGGT
TTCTGA


>TTHERM_00077240(protein)
MQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEASDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGF


>TTHERM_00077240(gene)
ATGCAAATCTTCGTTAAGACCCTTACTGGTAAAACCATTACTTTAGACGTTGAAGCCTCC
GACACTATTGAAAACGTCAAGGCTAAGATTCAAGACAAGGAAGGTATCCCTCCTGATCAA
TAAAGACTTATCTTCGCTGGTAAGCAATTAGAAGACGGCAGAACCCTTTCTGACTACAAC
ATTCAAAAGGAATCAACCCTCCACTTGGTTTTAAGATTAAGAGGTGGTATGCAAATTTTC
GTCAAGACCTTGACTGGTAAGACCATCACTCTTGACGTTGAAGCCTCTGACACTATTGAA
AACGTCAAGGCTAAGATCCAAGACAAGGAAGGTATCCCCCCTGATCAATAAAGACTTATC
TTCGCTGGTAAGCAATTAGAAGACGGCAGAACCCTTTCTGACTACAACATCCAAAAGGAA
TCTACCCTCCACTTAGTCCTCAGATTAAGAGGTGGTATGTAAATCTTCGTCAAGACCTTA
ACTGGCAAGACCATCACTCTTGATGTTGAAGCCTCCGACACCATTGAAAATGTCAAGGCT
AAGATCTAAGACAAGGAAGGTATCCCCCCTGATCAATAAAGACTTATCTTCGCTGGTAAG
CAATTAGAAGACGGCAGAACCCTTTCTGACTACAACATCCAAAAGGAATCTACTCTCCAC
TTAGTCCTTAGATTGAGAGGTGGTATGTAAATCTTCGTCAAGACCTTAACTGGCAAGACC
ATCACTCTTGATGTCGAAGCTTCTGACACCATTGAAAACGTCAAGGCTAAGATCCAAGAC
AAGGAAGGTATCCCCCCTGATCAATAAAGACTTATCTTCGCTGGTAAGCAATTAGAAGAC
GGCAGAACCCTTTCTGACTACAACATTCAAAAGGAATCAACCCTCCACTTGGTTTTAAGA
TTAAGAGGTGGTATGCAAATTTTCGTCAAGACCTTGACTGGTAAGACCATCACTCTTGAC
GTTGAAGCCTCTGACACTATTGAAAACGTCAAGGCTAAGATCCAAGACAAGGAAGGTATC
CCCCCTGATCAATAAAGACTTATCTTCGCTGGTAAGCAATTAGAAGACGGCAGAACCCTT
TCTGACTACAACATCCAAAAGGAATCTACCCTCCACTTAGTCCTCAGATTAAGAGGTGGT
TTCTGA